Conserved Protein Domain Family
DUF1198

?
pfam06711: DUF1198 
Protein of unknown function (DUF1198)
This family consists of several bacterial proteins of around 150 residues in length which are specific to Escherichia coli, Salmonella species and Yersinia pestis. The function of this family is unknown.
Statistics
?
PSSM-Id: 399593
View PSSM: pfam06711
Aligned: 7 rows
Threshold Bit Score: 219.601
Threshold Setting Gi: 490285791
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013574104          1 MIWIMLAAIVVVFIVGYWFMTADTRKANDSLASLLKIKPVYIDSMLLEMGKRQSQMFIRSISGGYAEEIRKAAYVVFIYQ 80  Rahnella
WP_002212217          1 MTWIIIAVLIVVFIVGYRVLTSDTRKAIDTISNLLKIKPIYIESMLQEMGPRQTQMFIRSTSNGSAEEVRKAAYLVFIYH 80  Yersinia...
goetting:EBL_c23370   1 MVWLMLATLVVVFVIGFRVLTSGPRRAVRRISERLAIEPVVVESMTDQMGRSAGGEFLRYLARPNDVHLQNAVQVLLIWQ 80  Shimwell...
WP_004181583          1 MIWIGLATLVVVFVVGFRVLTSDSRRAIRRLSERLGITPVPLESMIDQLGKTAGNEYLRYLERPNEAHLQNAAQVLLIWQ 80  Enteroba...
Q8ZL17                1 MIWLILATFVVVFIVGFRVLTSDTRRAIRRLSERLNIDVVPIESMIDQMGKTAGGEFLQYLHRPDESHLQNAAQVLLIWQ 80  Salmonel...
WP_013201224          1 MIWLMLVTLVVVFIIGFRVLNSQTRRASKALTKRLNLEPVYVESLINTMGRVAGEEFVQYLARDNEAHIANGASVLLIYQ 80  Erwinia
ACR70242              1 MIWLMLATLALVFIAGFRVLNTPTRRACQRLTQRLNIEPVYVESLLSQMGKTQGEAFVRYLQCGGESHLNNGAIVLLIYQ 80  Edwardsi...
WP_013574104         81 TFIKDPSEENIVRWRNILVRAHLPPQLSSEHAELALFYFAELDIEPFELAQFRRDYNETYNQ 142 Rahnella
WP_002212217         81 TFIKNPSDENVELWRNTLIRAQISPILAAEHTDAALFYFAELDLDAFELAQFRRHYNLHFNP 142 Yersinia pseudotuberculosi...
goetting:EBL_c23370  81 AAIIDDSEHNLQHWLRLLRKARMATPLSDGHIRLAMGFLRELEPDLPTLKAFQARYNQCFTP 142 Shimwellia blattae DSM 448...
WP_004181583         81 VAIVDASEKNLHYWYRLMQKARLAAPITEAQIRLAQGFLRELDPDMSDLHNLQQRYNDLFLP 142 Enterobacteriaceae
Q8ZL17               81 MVIVDGGDQNLQRWHRLLQKARLAAPITDTQVRLALGFLREMEPDMQEINAFQLRYNAFFQP 142 Salmonella enterica subsp....
WP_013201224         81 VFIVDESDESLMFWRGVLRKAYLPTELSNEHVRLAMSFLRELEPDAQEMLAFRQRYNARFAP 142 Erwinia
ACR70242             81 TFIVNGDDDNLRYWRTLLRKTGFNADISTHQVHLTLDFLRDLEPDTDEMLAFRLYYQHFFAQ 142 Edwardsiella ictaluri 93-146
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap