Conserved Protein Domain Family
DUF1191

?
pfam06697: DUF1191 
Protein of unknown function (DUF1191)
This family contains hypothetical plant proteins of unknown function.
Statistics
?
PSSM-Id: 399586
View PSSM: pfam06697
Aligned: 52 rows
Threshold Bit Score: 131.567
Threshold Setting Gi: 1142843872
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009112717  45 SSRLLDLLLRDYILNSFKnqHYsvKTGVVRHIHLPSNYSGINLDAVRFRCGSFRRYGAQLQEFHIGVGAILEPCGERLVL 124 field mustard
XP_002299498  25 NTDTLDAFLQDSAFKSLVrhRP--HTGALYKALLPANLSGVQVSIVRIRSRTLWNIGANFSNFQIPSRTMTLPHVRRLAI 102 black cottonwood
EEF51288     465 TTNSLDAFLQDSAFKTLVrhRP--QTGALYTALLPANLSGMEVSIVRLRSRRLWNIGANFSNFHIPSRTKTTPHVKRLAV 542 castor bean
XP_010658706  28 aSDSLDAFVQEFALRTLDhhRP--HTGPLYKAILPANLSGMEVSVVQLRSRQLWSRGAKFSNFRIPSRTMPVPHVKRLVL 105 wine grape
Q5S4T6        41 LPHSLSQSLENFALKTLTt-QH--HTGALYRAILPENLSGIEVSVVRLTGKSLWNSGAKFSNVLIPERSVSVPPARRVVI 117 thale cress
KRH06539      31 DRESLDDFLRKQANKETE--RL--RKGVLSNVYLPSNFTGMEVSVVRLRSFSLWSRGMNYSSFNLPPRIVLQPNAKRIAI 106 soybean
XP_010661872  32 DPESLDVFVHHQAWKALV--RP--YTGRLYRVHLPANFSTMEVSVVRLRSGSLWQRGVNFSSFHIPRRTLPMPYVKRLAI 107 wine grape
EEF50622      11 DPESLDASIYNYAVEALL--RQ--HTGKLLNVSLPSNFSGIKASVFRTRSGSLWQRGANFSSVYIPSGVIPFPFVKRLAI 86  castor bean
Q9M152        30 NISDLDDLIRSYAARATtr----rHTGSLYDVSLPSNLSDIKASVVTVRNSIFWRKGTNFSGVLIPPMVKTSPYAKRIAF 105 thale cress
RIA04975      41 LPHSLSQSLEDFALKTLTn-QH--HTGSLYRAVLPNNLSGIEVSIVRLTGKSIWNAGARFSNVLIPARSVSVPPARRVAI 117 field mustard
XP_009112717 125 VRQILGsNWSDiyYkNYDLS-GYRLVSPVLGLLVYNALNdIVLGNnfrsSYQISlLLDNAKdPSTVDFGNISGPSMVvve 203 field mustard
XP_002299498 103 VYQDLG-NWSS--Y-YYSVP-GYSMITPVVGFMVFNASN-ARAKR----IGKVS-LNTSGK-AIVIRFANSTITESMiss 170 black cottonwood
EEF51288     543 VYQDLG-NWSS--H-YYSVP-GYSMLTSVVGFMVFNASN-ARAKS----IKRIS-LDTNRR-NIIIHFANLTFHERLis- 609 castor bean
XP_010658706 106 IYQDLG-NWSS--Y-YYPVP-GYTLVSSVVGLIAYDASN-LDANR----IVQLS-LNTMGK-PISVHFGKLLFPRGRks- 172 wine grape
Q5S4T6       118 VYQNLG-NWSN--H-WYTVP-GYRLITSVLGFKVLDVSD-QDNVK----EIILK-MK---N-PVEVSFRD-LPKERDeem 181 thale cress
KRH06539     107 LFENLG-NWSS--N-YYNVP-NHTMVASVFGVMAYSSSE--TAFV----DEKIN-FTTHGD-PIRIRFPH-VDQHGEnd- 171 soybean
XP_010661872 108 VYENLG-NWSS--D-YYKVP-GFSLVSPVVGFMAYDATN-LSALG----NLKIN-FSISGD-PISIHFPSILVPKDEnk- 174 wine grape
EEF50622      87 VYQNLG-NRSS--H-YYKVP-GYSLVAPVVGFMAYDASN-LSLLG----REMLQ-LSIMGD-SIVVKFSKIVRKDGNpe- 153 castor bean
Q9M152       106 VFESFGdNSSS--V-YFRLAdNYSFVSPVIGFTGYDATN----TNd---LKKLN-LSIKRDkPILIKFDPHASRDRSk-- 172 thale cress
RIA04975     118 VYQNLG-NWSN--H-WYTVP-GYRLITSVLGFRVLDVSD-QDNVK----EISLK-MK---N-PVKILFRD-L---SDekm 178 field mustard
XP_009112717 204 rtflnkpMCAAFGLDG----KVTFAGEVKPYVCAVK-TNGHFGLVVT 245 field mustard
XP_002299498 171 -----gaKCVTFSASG----TFHLGEINLLNECHSQ-DHGHFSIVVP 207 black cottonwood
EEF51288     610 -----eaKCVAFSENG----TFHLSEINQLNVCYSQ-DQGHFSVVVP 646 castor bean
XP_010658706 173 -----eaRCAALCANG----TVYLSDMSLPSVCYSR-EQGHFSIVIP 209 wine grape
Q5S4T6       182 l---srvRCVSFKAQTkdeeATHISRMVIPGVCYGS-SHGDYSVIEP 224 thale cress
KRH06539     172 -----tpICAKFRAGG----LVKFKNMTKPYVCEVY-SQGHYTLVVP 208 soybean
XP_010661872 175 ------tKCVTFGDDG----SVQFSNMTTPNVCFAQ-GQGHFSVVVP 210 wine grape
EEF50622     154 -----dlKCVKIGEGG----TVQFRNVTEGNTCLAQ-SDGHFSLVVP 190 castor bean
Q9M152       173 ------vKCIVFGDNGl---LLNISNTIRNYECATTnSHGHYALVVL 210 thale cress
RIA04975     179 l---srvSCVSFKAQNedkeAARISRMILPGVCYGS-SHGDYSVIEP 221 field mustard
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap