Conserved Protein Domain Family
DUF1186

?
pfam06685: DUF1186 
Protein of unknown function (DUF1186)
This family consists of several hypothetical bacterial proteins of around 250 residues in length and is found in several Chlamydia and Anabaena species. The function of this family is unknown.
Statistics
?
PSSM-Id: 369037
View PSSM: pfam06685
Aligned: 6 rows
Threshold Bit Score: 367.877
Threshold Setting Gi: 7388392
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Cal6303_0325   1 MELAEIIEQLKYNeTRIFPREAVEGAISQQAAITPVLIETLKECKNNFDELLEDSGYILHIYALYLLAQFREKAAYSVII 80  Calothrix s...
Q8YLB6             1 MQVEEILAQLEIN-TKTFPRLALEAAIEQREAITPILISTLDKLSENLEQLLEKEDYILHIHALYLLAQFREESAYPTII 79  Nostoc sp. ...
WP_015213381       1 MQLEEILSELENN-TGKFPRLALERAIQEQEAITPLLLATLEESKNNLEDLLEEPDYFLHIYSLFLLAQFRESKSYPIIV 79  Anabaena cy...
WP_012102589       1 --mNALLEQIKYA-NGKFPEEQIRQIISRKEEFIPELIEILRSAEDNYNEILGKPNYFLHIYAAYLLAQFNEEQSFSLII 77  Clostridium...
O84206             3 MEISHILEDLVYD-NGVLPREAIEAAIVKHHQITPYLLKILEEAIDHVSDIIDDDCYQGHLYAMYLLAQFRETRALPLII 81  Chlamydia t...
Q02D22             1 MELQEIVLRMERW-RGKFERKAVEAAVERREEITPELLWLLDETTNRAEELAPEGDWIGHLYAMCLLTQFRELRAYPLVL 79  Candidatus ...
jgi:Cal6303_0325  81 DFFSTPGDTAMDITGDVVTEDLGRIITSVFDGNLDPIKQLIENQEANEYVRGAAIDSLMTLLAQDIITRQEVVEYFGELF 160 Calothrix s...
Q8YLB6            80 KFFSVPGDVALDVTGDIVTEDLGRILACVSGGRIEPIKQLIENSKANEYVRGAALEALLVLIAQEVITREQVIQYYAKLF 159 Nostoc sp. ...
WP_015213381      80 DFFSTPGDISLDVTGDVVTEDLGRILASISHGNLDPIKQLVENPAVNKFVRGAALKSLVILLVQKIISREQVVQYFEELF 159 Anabaena cy...
WP_012102589      78 DLISLPDEIVFKIFGDVVTEDLHRILASVCKGNVQPVKELLENENVNEYIRVAAIKTFPVLWVEGVISKDEIIKYYRSLL 157 Clostridium...
O84206            82 KLFSFEQDIPHAIAGDVLTEDLSRILASVCD-DVALIQELIETPHVNPYVQAAAISSLVALVGVHKLSRETAIRYFGELL 160 Chlamydia t...
Q02D22            80 RFGRLPGKLLDELCGDFLTEDYEKVLASVSGGDISGIQSLIQDESVDVWVRSVALSSLLVLVAEGQRSREEIVDYFRRLF 159 Candidatus ...
jgi:Cal6303_0325 161 qGKIERNaDNYLLNKLIIDICDLCPLELKPYIDQAFDEDLVDPMFIAREEVDESI-ELGIEGALEKLRDDHHHVLIDNII 239 Calothrix s...
Q8YLB6           160 -STLDKE-DHYIQTTLVTNSAQLCAVELQEQINRAFEQNSVDLFFIDQEDVSTYL-VVEKEEALNRLRKNPKYSFIKDVI 236 Nostoc sp. ...
WP_015213381     160 lSKLEKD-NSHMWNKLVINSCDICAIELKEHIDRAFEEDLMERFFVNENNVNNSL-EMGVEAALQKLHNKQHYTLINDTI 237 Anabaena cy...
WP_012102589     158 kEKLKRE-RSVVWGSLVSSCCEICPDELYEEIKEAYKDNLIENFYISLEEVEENF-DIEDDERILNLKRR-GYEFIRDTI 234 Clostridium...
O84206           161 nYRLEKK-PSFAWDSLVASICALYPKELFYPISKAFSAGLIDTSFISMEDVETIIhEESIDSCLKEVLSST--DLINDTL 237 Chlamydia t...
Q02D22           160 rGGLERK-LSYVWTSLVNCSCDLYPGELLPDIERAYRDGLVDSSQVGMKDVERDL-ARGKDWVLARLVNGGRHRLIDEAA 237 Candidatus ...
jgi:Cal6303_0325 240 TEMEWWAGF 248 Calothrix sp. PCC 6303
Q8YLB6           237 LEMENWSCF 245 Nostoc sp. PCC 7120
WP_015213381     238 LEMESWNCF 246 Anabaena cylindrica
WP_012102589     235 KDLEYWPCF 243 Clostridium kluyveri
O84206           238 EEMEKWLER 246 Chlamydia trachomatis D/UW-3/CX
Q02D22           238 EHIEKWCpa 246 Candidatus Solibacter usitatus Ellin6076
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap