Conserved Protein Domain Family
AA_synth

?
pfam06684: AA_synth 
Amino acid synthesis
This family of proteins is structurally similar to proteins with the Bacillus chorismate mutase-like (BCM-like) fold. This structure, combined with its genomic context, suggest that it has a role in amino acid synthesis.
Statistics
?
PSSM-Id: 399578
View PSSM: pfam06684
Aligned: 48 rows
Threshold Bit Score: 215.492
Threshold Setting Gi: 357938842
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Veis_0855              4 IRRVFTQLEDIRHEFGPVADRPLLRGAIAAVLSNPYAGR-YE--QDILA-LMDALQDVGLDLARRLLQTLAVpAGRIEGY 79  Ver...
goetting:OCA5_c06340      10 IRQFHMFEREILSEAGKPADKVVRHIVAGVVFENPFAGKgAAsdADLAR-LAEISVEVGGMLTKRVLERFSG-QERPRAY 87  Oli...
calssnu:BYI23_C002530     10 IRQIHVFERDILSEAGEKASRPSRHVIAAAIFKNPYAGQgAAsaDDLAR-LAGLSVEVGALLTERALSRFAG-GERPRAY 87  Bur...
WP_011796846               3 IRRFFIQKETIPPAPQRPAARQVQRVVAAAVLENPFAGR-WQ--EELSA-LYPAGHAIGERLTAEALRQIDGgAAAVEAY 78  Aci...
Q13HU8                     5 IARIVVHLVERCAELGTPVTPPHRQVVAAAVLKTTDQDVaWE----LEA-LYATGADLGQMLTGRALLALGCaGEDIQGY 79  Par...
PRJNA212980:JCM7686_1839  20 IRKTIAHLEEVHRELDRPVEGRKLKAAVGIILTNEFAGR-YV--EDLSP-LIAAGAEVGEALVTELAALLGErIAEVSAY 95  Par...
WP_015929176               6 LRKIVSQLEETLSECGRPVEPATKKVAVTAVIKNPYAGR-YV--EDLTP-LYDLGAEVSKILAERGVALLGVaPDQVQSY 81  Met...
Q2JZ96                     5 IRKFTTFLEETLVEGGRAASRPVNIVVVAAVIQNPWAGRgFV--EDLRPeIIRIAGELSHEMTNRLLRQIGP--EQIEAC 80  Rhi...
Q11FC0                     5 IRKFAAFVEETVIEAGKPAARPITSVVIAAVLPNPWAGQgFV--EDLGPeIRRIAPELGAEMTRRLISLMDP--DRVEAF 80  Che...
jgi:Psefu_1102             5 VRKYCTFIEQTLIEGDREAERPITMVVVAAVLKNPWAGKgYV--DNLRPeIMEIAPLLGKEMTDRLIALMPA--DRIEAY 80  Pse...
jgi:Veis_0855             80 GKGAIVGAAGELEHG-ALWHV-PGGYAMRELLGwqaersadarsakgakgtkdpqgargrgqgaNALAIVPATKKVGAPG 157 Ver...
goetting:OCA5_c06340      88 GKGVIVGSNGDSEHGaALIHP-RIGLAMRRGLG-------------------------------AGPALIPGNAKVGGPG 135 Oli...
calssnu:BYI23_C002530     88 GKAVIVGTQGESEHGaALIHP-RLGLAMRTGLG-------------------------------AGPALIPGNAKVGVAG 135 Bur...
WP_011796846              79 GKGAIVGYGGDMEHAaALLHP-LFGRAVRAGLP-------------------------------GAQSIMPSTAKRGGPG 126 Aci...
Q13HU8                    80 GKAALAGAGVPLEWGaALLHP-RLGKAVRDCLP-------------------------------GASSIMPSVTKRGPAG 127 Par...
PRJNA212980:JCM7686_1839  96 GKGAIVGGRGELEHAaALIHP-KFGAPVRKRLG-------------------------------RGPAIIPSTKKFGGPG 143 Par...
WP_015929176              82 GKGAIIGTDGEIEHSaALLHP-RFGAPVRAAVG-------------------------------SGKDIIPGTKKVGAAG 129 Met...
Q2JZ96                    81 GKAAAVGINGEIEHAsAMIHTlRFGNPFREAI--------------------------------GGTNYLEFANTRNAPG 128 Rhi...
Q11FC0                    81 GKAACVGVNGEIEHAsALIHTlRFGNHFRDAV--------------------------------HGTAFLSFSNTRNAPG 128 Che...
jgi:Psefu_1102            81 GKAASVGTNGEIEHAsGLIHTlRFGNKFREAA--------------------------------EGTAFLSFTNVRNGPG 128 Pse...
jgi:Veis_0855            158 CALDVPLTHINASYVRSHFDTIELRVPGAPAADELIVILAMSTGpRIHARV 208 Verminephrobacter eiseniae EF01-2
goetting:OCA5_c06340     136 TSIDILFGGAEDAWDYDAMDGTTVSIPGGPAANEIALFVGFGTT-RVNARI 185 Oligotropha carboxidovorans OM5
calssnu:BYI23_C002530    136 SSIDLIFGGADDAWDYDAMDGITLSVPGGPAPDEFVLFVGFGTV-RVNARV 185 Burkholderia sp. YI23
WP_011796846             127 TLLDVPVHHVLDPWSFDHFDAVTFGIAEAPLPEEIVVALVLCAGgRPMARV 177 Acidovorax citrulli
Q13HU8                   128 ACIDIPMHSVTDMWSFDHFDTVSLCIPDSPAPDELLVAVALAERgRPLARV 178 Paraburkholderia xenovorans LB400
PRJNA212980:JCM7686_1839 144 SSITVPLTNCDDIWQFDEMDALEITCPDGPREDELFLVLAVGIGgRPLKRV 194 Paracoccus aminophilus JCM 7686
WP_015929176             130 STIVMPMTNKDNIWDFDHMDSIEVTIPDAPKPDEIVISVCLGIGgRPLHRV 180 Methylobacterium nodulans
Q2JZ96                   129 ALLSLPMMHKSENGKRSHFLTANFQIADAPGPDEIIVAIGASDSgRAHARI 179 Rhizobium etli CFN 42
Q11FC0                   129 ALLSLPMIHKSETGKRSHFLTANFQIADAPGPDEILVAIGASDGgRAHPRI 179 Chelativorans sp. BNC1
jgi:Psefu_1102           129 ALISVPMVHKTATGQRSHFLTATFQIADAPGPDEVLVAIGAADGsRPHPRI 179 Pseudomonas fulva 12-X
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap