Conserved Protein Domain Family
DUF1170

?
pfam06663: DUF1170 
Protein of unknown function (DUF1170)
This family represents a conserved region of unknown function within MAGUIN, a neuronal membrane-associated guanylate kinase-interacting protein. This region is situated between the pfam00595 and pfam00169 domains. All family members also contain an N-terminal pfam00536 domain.
Statistics
?
PSSM-Id: 429057
Aligned: 16 rows
Threshold Bit Score: 205.794
Threshold Setting Gi: 1249039360
Created: 27-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_419685     333 SVKKEKPAILDLYIPPPPAVPYSPRDEKGSFLYGGGSKPSHPllgskGAESPNSFLDQESRRRRfTIADSD---QLPGY- 408  chicken
XP_012947481  340 MSSKMENSALQDVYILSPMSGLYGPRDEIGIMSCDDISKFgks--gmKGSESPSYFLEHESGKY-YTLIEG---EGHALg 413  mallard
Q8WXI2        339 TPTKRDSSALQDLYIPPPPAEPYIPRDEKGNLPCEDLRGHMVgkpvhKGSESPNSFLDQEYRKR-FNIVEE---DTVLYc 414  human
XP_022537553  290 TPSKRDSSALQDLYIPPPPAEPYTPRDEQGNLPCDERGQGgip--aaKGSESPNSFLDQEYRRR-YPLMEE---EAVLYc 363  Mexican tetra
NP_001135662  332 SSLKKEKPAILDLYIPPPPSVPYFPR---TEVGSSGSNRCVYpipgsEGSESPNSFLDHESRRRwFTIANS---DQLFS- 404  tropical claw...
XP_015210451  335 SPIKKEKPAILDLYIPPPPAVPYTPRDVKGHKYAGVTARP-------KGSESPNSFLDLESRRR-FTIADY---EQLGV- 402  spotted gar
XP_022533858  357 NSVKKEKPAILDLYIPPPPAVPYAPRDVKSSVCSGVTMRT-------KRHESPNSSLDRAGRRR-SNLSDYianQPVIVv 428  Mexican tetra
AAI54537      333 SIRRPEKPAILDLYIPPPPSVPYSPRDAEKSEYAGVKMRP-------KGSESPNSSLDLANRRR-SNISDY---NNKPTv 401  zebrafish
CAG09880      342 KLAKKEKPAILDLYIPPPPPVPYAPREVRMDTVSSISQRP-------KGSESPNSFLDLENRRR--TVTDY---DKLNFg 409  spotted green...
XP_023208339  332 GSTKKEKPAIMDLYIPPPPPVPYTPREMRSDSLSSISKRP-------KGSESPNSFLDQERRQR-TTITDY---DKLNPg 400  southern plat...
XP_012947481  340 MSSKMENSALQDVYILSPMSGLYGPRDEIGIMSCDDISKFgks--gmKGSESPSYFLEHESGKY-YTLIEG---EGHALg 413  mallard
Q8WXI2        339 TPTKRDSSALQDLYIPPPPAEPYIPRDEKGNLPCEDLRGHMVgkpvhKGSESPNSFLDQEYRKR-FNIVEE---DTVLYc 414  human
XP_022537553  290 TPSKRDSSALQDLYIPPPPAEPYTPRDEQGNLPCDERGQGgip--aaKGSESPNSFLDQEYRRR-YPLMEE---EAVLYc 363  Mexican tetra
NP_001135662  332 SSLKKEKPAILDLYIPPPPSVPYFPR---TEVGSSGSNRCVYpipgsEGSESPNSFLDHESRRRwFTIANS---DQLFS- 404  tropical claw...
XP_015210451  335 SPIKKEKPAILDLYIPPPPAVPYTPRDVKGHKYAGVTARP-------KGSESPNSFLDLESRRR-FTIADY---EQLGV- 402  spotted gar
XP_022533858  357 NSVKKEKPAILDLYIPPPPAVPYAPRDVKSSVCSGVTMRT-------KRHESPNSSLDRAGRRR-SNLSDYianQPVIVv 428  Mexican tetra
AAI54537      333 SIRRPEKPAILDLYIPPPPSVPYSPRDAEKSEYAGVKMRP-------KGSESPNSSLDLANRRR-SNISDY---NNKPTv 401  zebrafish
CAG09880      342 KLAKKEKPAILDLYIPPPPPVPYAPREVRMDTVSSISQRP-------KGSESPNSFLDLENRRR--TVTDY---DKLNFg 409  spotted green...
XP_023208339  332 GSTKKEKPAIMDLYIPPPPPVPYTPREMRSDSLSSISKRP-------KGSESPNSFLDQERRQR-TTITDY---DKLNPg 400  southern plat...
XP_419685     409 HMEA-NILPAKMREKTQSYGKPRPLSMPADGSWIGAAEPFSRPRAPGRKGEDVLCRYFSNERIPPIIEESPSTQHPFSrP 487  chicken
XP_012947481  414 SEYErSRATGVRRREKTPTHGDLRPVSMPTDYSWIGESKEQNMYKRGSRDSENSLLRYLSDDKILVIQEEP-LTQKDSkR 492  mallard
Q8WXI2        415 YEYEkGRSSSQGRRESTPTYGKLRPISMPVEYNWVGDYEDPNKMKRDSRR-ENSLLRYMSNEKIA---QEEYMFQRNSkK 490  human
XP_022537553  364 YEYDpSRGAPPSRRESTPTYGRLRPISMPVEYNWVPDYEDPARPKREGRR-ENSMLRYVSEDKVP----EEYLTGRSAkR 438  Mexican tetra
NP_001135662  405 SPLE-VKVQPAKLRDKTPSYGKPRPLSMPAEPSWMVPPETYSRHRLAGKKGEGVLSRYFSNEQITPITEENIYSCSNLtK 483  tropical claw...
XP_015210451  403 CPAG-APALPARMRERTSSHGKPRPLSMPVDGSCLGPMDNCSKPWTAGRKGEDALYRYMSNERIPPIIEESPSVHQLY-R 480  spotted gar
XP_022533858  429 PAPE-PVVPQARLRQRTPSRGKPRPVSMPAD-ACLGLSHSPCPPRGLGRKGEDALRRYLSNERIPTISEESPCYPVPY-R 505  Mexican tetra
AAI54537      402 QPAE-AAVPQARMRQRTPSRGKPRPVSMPVD-TCLGMSDSPSRPWALGRKGDELLHRYLSNEQIPTISEESPCYPLPY-R 478  zebrafish
CAG09880      410 CPIE-ANVIQPKMREPKPSRGKPRPISMPAD-TCLRVTDPYARPWAQGRKGEDLLYRYLSNERIPTIAEELPSVSPPY-R 486  spotted green...
XP_023208339  401 CPIE-ATVIQPRMREHKASRGKPRPLSMPAD-TCVAVVDTYAKPWAHGRKGEDLLYRYLSNERIPTIAEEVPSASSPY-R 477  southern plat...
XP_012947481  414 SEYErSRATGVRRREKTPTHGDLRPVSMPTDYSWIGESKEQNMYKRGSRDSENSLLRYLSDDKILVIQEEP-LTQKDSkR 492  mallard
Q8WXI2        415 YEYEkGRSSSQGRRESTPTYGKLRPISMPVEYNWVGDYEDPNKMKRDSRR-ENSLLRYMSNEKIA---QEEYMFQRNSkK 490  human
XP_022537553  364 YEYDpSRGAPPSRRESTPTYGRLRPISMPVEYNWVPDYEDPARPKREGRR-ENSMLRYVSEDKVP----EEYLTGRSAkR 438  Mexican tetra
NP_001135662  405 SPLE-VKVQPAKLRDKTPSYGKPRPLSMPAEPSWMVPPETYSRHRLAGKKGEGVLSRYFSNEQITPITEENIYSCSNLtK 483  tropical claw...
XP_015210451  403 CPAG-APALPARMRERTSSHGKPRPLSMPVDGSCLGPMDNCSKPWTAGRKGEDALYRYMSNERIPPIIEESPSVHQLY-R 480  spotted gar
XP_022533858  429 PAPE-PVVPQARLRQRTPSRGKPRPVSMPAD-ACLGLSHSPCPPRGLGRKGEDALRRYLSNERIPTISEESPCYPVPY-R 505  Mexican tetra
AAI54537      402 QPAE-AAVPQARMRQRTPSRGKPRPVSMPVD-TCLGMSDSPSRPWALGRKGDELLHRYLSNEQIPTISEESPCYPLPY-R 478  zebrafish
CAG09880      410 CPIE-ANVIQPKMREPKPSRGKPRPISMPAD-TCLRVTDPYARPWAQGRKGEDLLYRYLSNERIPTIAEELPSVSPPY-R 486  spotted green...
XP_023208339  401 CPIE-ATVIQPRMREHKASRGKPRPLSMPAD-TCVAVVDTYAKPWAHGRKGEDLLYRYLSNERIPTIAEEVPSASSPY-R 477  southern plat...
XP_419685     488 MSEKQLVRGMDYIRGSRCFMNTDLHNSATIPFQEEGAKKSSV---TSSTKSSSAEPSLLVSW 546  chicken
XP_012947481  493 DTGHR-------------------------------SRKKG----KNASSPNYPISSSMLTS 519  mallard
Q8WXI2        491 DTGKK-------------------------------SKKKGD---KSNSPTHYSLLPSLQMD 518  human
XP_022537553  439 DTGKR-------------------------------TKKKSE---KSGSPAHYSLLPALQME 466  Mexican tetra
NP_001135662  484 PASRR-LVRGADYVRASPSLLNMDLHNSSTMPYQEDVEKKHN---ASSSSKNSSTEPSFLVS 541  tropical clawed frog
XP_015210451  481 PATDRHLIRAADHFRGSRYFTNADLHNSATIPYQEDSPKKSPgssSSSSSRTASAEPSLLVS 542  spotted gar
XP_022533858  506 PTGAR-LVRGVDHIRGSQCFINADLHNSATIPYQEAVARKK----TSKSSKRPPSESSLFSS 562  Mexican tetra
AAI54537      479 PAGERQLVRGVDHIRGSQCFINADLHNSATIPYQEAVARKP----ASKSSKRPPSEPSVFSS 536  zebrafish
CAG09880      487 PAGERHLIR-VDHIRGNRYFSNSDLHNSATIPYQED-ARKAP---VAPVTKRTSAERSLLVS 543  spotted green pufferfish
XP_023208339  478 PARERQLVR-VDRIRHSCYYSNSDLHNSATIPYQED-TKKAP---VSSISKRTPAERSLLVS 534  southern platyfish
XP_012947481  493 DTGHR-------------------------------SRKKG----KNASSPNYPISSSMLTS 519  mallard
Q8WXI2        491 DTGKK-------------------------------SKKKGD---KSNSPTHYSLLPSLQMD 518  human
XP_022537553  439 DTGKR-------------------------------TKKKSE---KSGSPAHYSLLPALQME 466  Mexican tetra
NP_001135662  484 PASRR-LVRGADYVRASPSLLNMDLHNSSTMPYQEDVEKKHN---ASSSSKNSSTEPSFLVS 541  tropical clawed frog
XP_015210451  481 PATDRHLIRAADHFRGSRYFTNADLHNSATIPYQEDSPKKSPgssSSSSSRTASAEPSLLVS 542  spotted gar
XP_022533858  506 PTGAR-LVRGVDHIRGSQCFINADLHNSATIPYQEAVARKK----TSKSSKRPPSESSLFSS 562  Mexican tetra
AAI54537      479 PAGERQLVRGVDHIRGSQCFINADLHNSATIPYQEAVARKP----ASKSSKRPPSEPSVFSS 536  zebrafish
CAG09880      487 PAGERHLIR-VDHIRGNRYFSNSDLHNSATIPYQED-ARKAP---VAPVTKRTSAERSLLVS 543  spotted green pufferfish
XP_023208339  478 PARERQLVR-VDRIRHSCYYSNSDLHNSATIPYQED-TKKAP---VSSISKRTPAERSLLVS 534  southern platyfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap