Conserved Protein Domain Family

pfam06648: DUF1160 
Protein of unknown function (DUF1160)
This family consists of several hypothetical Baculovirus proteins of unknown function.
PSSM-Id: 148323
Aligned: 14 rows
Threshold Bit Score: 142.387
Threshold Setting Gi: 1175100
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
A0EYW2  86 NQMYLDCYLIDILQRYIDYNQLNDENVHYVAEFLVLEINKAliNG 130 Ectropis obliqua nucleopolyhedrovirus
Q06669  87 HALLNNVSVTFTLHRFVDDNVLTQDELSFLANFLVTKMDEA--YQ 129 Autographa californica nucleopolyhedrovirus
Q2NNZ6  87 RVFLGNRKMVNITQKFVDGYRLSDDDISELSNFLVTQVDEV--YQ 129 Hyphantria cunea nucleopolyhedrovirus
Q91GI6  87 CAVFSNRNVMVIIQTFVSGYRLSSEDISEFSNFLVTQMNEV--YQ 129 Epiphyas postvittana nucleopolyhedrovirus
Q6VTR9  87 CAFLANRKIVSVVQTFVDGYRLSGEDISALSNFLVTQMNEV--YQ 129 Choristoneura fumiferana DEF multiple nucleopolyhedrovirus
Q80LN7  84 YQAVNNNNVIHILQLFTKGHCLTDEHINDIAAFIVYEINNAiiQK 128 Adoxophyes honmai nucleopolyhedrovirus
Q0IL32  82 NRVYENDQLISIIENFIEHQSLRPDEINYVSEFLVHEINDIsnYN 126 Leucania separata nucleopolyhedrovirus
Q9J843  84 NQVYYNGHILHILQTFIDYQHLTDDEINDLSQFLVKEIDNAimIN 128 Spodoptera exigua multiple nucleopolyhedrovirus
Q287H1  84 SQVYYNSHIIHILRSFINFQHLNDEEISDLSQFLVKEIDNAimVD 128 Agrotis segetum nucleopolyhedrovirus A
Q91BF3  83 SRMFSNERIMSIANVYIERQKLNSDEVNDVAEFLVHEVNNAlvYG 127 Spodoptera litura nucleopolyhedrovirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap