6WVE


Conserved Protein Domain Family
SPC12

?
pfam06645: SPC12 
Click on image for an interactive view with Cn3D
Microsomal signal peptidase 12 kDa subunit (SPC12)
This family consists of several microsomal signal peptidase 12 kDa subunit proteins. Translocation of polypeptide chains across the endoplasmic reticulum (ER) membrane is triggered by signal sequences. Subsequently, signal recognition particle interacts with its membrane receptor and the ribosome-bound nascent chain is targeted to the ER where it is transferred into a protein-conducting channel. At some point, a second signal sequence recognition event takes place in the membrane and translocation of the nascent chain through the membrane occurs. The signal sequence of most secretory and membrane proteins is cleaved off at this stage. Cleavage occurs by the signal peptidase complex (SPC) as soon as the lumenal domain of the translocating polypeptide is large enough to expose its cleavage site to the enzyme. The signal peptidase complex is possibly also involved in proteolytic events in the ER membrane other than the processing of the signal sequence, for example the further digestion of the cleaved signal peptide or the degradation of membrane proteins. Mammalian signal peptidase is as a complex of five different polypeptide chains. This family represents the 12 kDa subunit (SPC12).
Statistics
?
PSSM-Id: 429050
Aligned: 133 rows
Threshold Bit Score: 50.1727
Threshold Setting Gi: 51701967
Created: 27-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6WVE_A              154 MDYKGQKLAEQIFQGIILVSAVIGFIYGYVTEQFGWTVYIVMAGFAVSCLLTLPPWPMYRRNPLN 218
XP_001705052          1 MDYRGQIRAGHLMRLIIILFALFGLLTAWAFKNMGIGLLVHAFGLCLAALATVPDWPYYNQMEIA 65  Giardia intestinalis
EDS89400             11 IDFVGQRIVNKNISTLIPIITILGFIIGFITQNVFVMLSIYGIGLAFCLLAFGLPMPYLRANYIE 75  Entamoeba histolytica H...
XP_001306765          2 VDFQGQSFIFWTSAALLTLSVPIAIIYAFIVDNYLKGLMVIVYLSAGLFIAFVPNWPWLNRNKPN 66  Trichomonas vaginalis G3
EGF83230              9 IDFHGQRLVDRYSTGLLVLTGLVGFFTGFTTQSIMSVLVVDAIGLAVTCLVCLPAWPIYNQNQPK 73  Batrachochytrium dendro...
Q6BUY5               12 IDFKGQEKAEDIVHKSNYLIIPISLIIGWLTQDLFSTVISFLVQFAIVLLIVLPNWPLYNKNPVS 76  Debaryomyces hansenii
WGS:AATM:SJAG_01750  28 IDFQGQIACRNILNNGIPIISAISFVCGLIAQDSNYVFICFGLLSIILLFICVPAWPHFNKHPVA 92  Schizosaccharomyces jap...
XP_013021110          8 IDFNGQIRCAKYMNYGILMSGVGAYIAGWFAQDSYLSIIVFFILAAVVGIICIPAWPMYNRKPLQ 72  Schizosaccharomyces cry...
G2TRR4                8 IDFAGQLRCQKYMNYGLCTSAVISYIYGYLVQDSYCVIKLFLILASLVALVCLPAWSMYNKNPLK 72  Schizosaccharomyces pom...
A0DCS0               20 MDFESQLFVKKIYKIIILTVAIISFIIAFFLERFSVCVYSTIGSSVLCILVLAPAWPMWKKNQPN 84  Paramecium tetraurelia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap