Conserved Protein Domain Family
SPC12

?
pfam06645: SPC12 
Microsomal signal peptidase 12 kDa subunit (SPC12)
This family consists of several microsomal signal peptidase 12 kDa subunit proteins. Translocation of polypeptide chains across the endoplasmic reticulum (ER) membrane is triggered by signal sequences. Subsequently, signal recognition particle interacts with its membrane receptor and the ribosome-bound nascent chain is targeted to the ER where it is transferred into a protein-conducting channel. At some point, a second signal sequence recognition event takes place in the membrane and translocation of the nascent chain through the membrane occurs. The signal sequence of most secretory and membrane proteins is cleaved off at this stage. Cleavage occurs by the signal peptidase complex (SPC) as soon as the lumenal domain of the translocating polypeptide is large enough to expose its cleavage site to the enzyme. The signal peptidase complex is possibly also involved in proteolytic events in the ER membrane other than the processing of the signal sequence, for example the further digestion of the cleaved signal peptide or the degradation of membrane proteins. Mammalian signal peptidase is as a complex of five different polypeptide chains. This family represents the 12 kDa subunit (SPC12).
Statistics
?
PSSM-Id: 399559
View PSSM: pfam06645
Aligned: 135 rows
Threshold Bit Score: 58.6533
Threshold Setting Gi: 51701967
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001421173   1 MHYRAQRLSERLALVALSTSAIVAFACGWFASDYDLLKRIYFGGVCGTVAIVVPHWEWiYgSKDGMKWRASTG 73  Ostreococcus lucimarin...
XP_011274912  16 IDFKSQKFTEDISYKLLIVGAILSSLAGFVAQDIKVLLVFSGLTILVTLGIVIPPYPG-Y-NTENIEWYSPKi 86  Wickerhamomyces ciferrii
P46965        16 IDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISCVITLICVLPAYPW-Y-NKQKLRWAQPKI 86  Saccharomyces cerevisi...
CAR29574      16 LDFPSQRYTERLQQITLLVGAIVASIVGLSTQSLKNLIIVYGISIAITALVVLPAYPA-Y-TRRKLQWVQPKV 86  Zygosaccharomyces rouxii
XP_003681933  16 IDYPSQEKTEWLQNALLALGALISCVVGFYKQSLVYLLAVYIFSVVLTLIVVLPAYPA-Y-TARKLEWVRPKi 86  Torulaspora delbrueckii
CCK72992      16 VDYPSQTLLAKRHKLLVVIGALVSGVVGVATQSILQMGVCYLCFVFVALLLVLPAWKS-Y-RVHNLEWVQPQA 86  Kazachstania naganishi...
XP_003683540  16 IDFKAQSSLTTKLNNILLVGSIFAMIYGYSTQSLSNAFYSYIAFISIAAMAVVPSYPS-Y-NKHKLEWVKPKI 86  Tetrapisispora phaffii...
XP_001645777  16 IDFQAQKEVSKKLTVILSVGVLFTSIYGYITQSLFNLLVAYGVIILVASLVIVPAYPS-Y-NKHKLQWVTPKv 86  Vanderwaltozyma polysp...
CAR58002      19 VDFKAQERIEKLAYVILGIGAVTSFGIGFVTQSLQNLLVCFGGFFVVTLIVTLPPYSC-Y-KKNQLKWVQPKV 89  [Candida] glabrata
XP_002551871  16 IDFASQRRLDRSVYLCLMIGTVVSCFIGLFTQSLFNLVVSFGLTFCVCLALGLPSYPA-Y-NKQRLEWVKPKI 86  Lachancea thermotolera...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap