Conserved Protein Domain Family
DUF1158

?
pfam06643: DUF1158 
Protein of unknown function (DUF1158)
This family consists of several enterobacterial YbdJ proteins. The function of this family is unknown
Statistics
?
PSSM-Id: 399557
View PSSM: pfam06643
Aligned: 3 rows
Threshold Bit Score: 83.7964
Threshold Setting Gi: 81523664
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002439128     3 RHPLETLVSAGGILLLALLSCLLLPAPAFSLQMAHWLMATFHLQDLNQLYTLVFCLWFLLLGAVEYVVIRFIWRRWFS 80  Shimwellia blattae
Q8ZR42           2 KHPLESLMTAAGILLMALLSSLLLPAPSLGLALAQKLVGIFHLMDLNQLYTLLFCLWFLLLGALEYYVIRFIWRRWFS 79  Salmonella ente...
wugsc:KPN_00557  2 KHPLETLLSAAGILLLALLSCLLLPAPSLGLTLAQKLVETFHMMDLNQLYTVLFCLWFLALGAIEYLVLRWVWRRWFS 79  Klebsiella pneu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap