Conserved Protein Domain Family
XRCC4

?
pfam06632: XRCC4 
DNA double-strand break repair and V(D)J recombination protein XRCC4
This family consists of several eukaryotic DNA double-strand break repair and V(D)J recombination protein XRCC4 sequences. In the non-homologous end joining pathway of DNA double-strand break repair, the ligation step is catalyzed by a complex of XRCC4 and DNA ligase IV. It is thought that XRCC4 and ligase IV are essential for alignment-based gap filling, as well as for final ligation of the breaks.
Statistics
?
PSSM-Id: 369011
View PSSM: pfam06632
Aligned: 10 rows
Threshold Bit Score: 448.398
Threshold Setting Gi: 941808049
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6PBP2         5 SSSVRQISISSEPQRCFFLKLEWA-EDLGSGFVIFLCDGESAWSGEVSEEDVSREAREMEMERDRYVCDLQLALTgapsg 83  zebrafish
XP_005996715   2 QKQVCKIQPVCEPDSIYYLCITWK-DNIGRGFDLILCDGQSAWTGTVSEEEISKEAVEVAMEREKYVDELCKALT----- 75  coelacanth
XP_015216180   2 GTSVRRISISSEPGKIFFLRVKRG-EDLGSGFSVVLCDGQSAWSGAVSEEEVSREAKEMEMKRENYVKDLSQALLt---- 76  spotted gar
XP_014328982   2 KTSVREIHLSSQADFSYFLRVDWEgRGLGFGFKLLLTDGQKAWRGKVSEAVVNEEAEELEMAKEKYIQDLQLALT----- 76  southern platyfish
NP_001106551   2 EKKIRKIYISSYPGTIYFLQISWK-KDLGNGFAVALTDGKSAWTGEVFPEDVTQEAKDMEMERSNYVDELRKALI----- 75  tropical clawed...
XP_003759919   4 EHNMSRIHMVSEPSIIYFLQVSWE-KDLGSGFDITLTDGQSAWNGTVTASEISREADDMAMERDKYVDELRKALV----- 77  Tasmanian devil
Q5XI44         2 ERKVSRISLASEPNVTYFLQVSWE-GTIGSGFVITLTDGHSAWTAKVSESEIAQEADDMAMEQEKYMDELRRALV----- 75  Norway rat
NP_001075084   2 ERKVSRVCLASEPDIIHFLQVAWE-KTLGSGFVITLTDGQSAWTGTVCESDISQEADDMAMEKEKYVDELRKALV----- 75  cattle
XP_015136170   2 EKTLIRIHPVSDPEAVYFLQVSWE-KDVSSGFGIILTDGERAWTGTVSEAEISREAADMEMNREKYVEELKKALI----- 75  chicken
XP_008101212   2 EKKVRRIYPLSEPGTTYFLQIVWE-KDLGTGFDVILTDGQSAWSGRVPKEEISREAADMEMEQKKYVEELRKVFL----- 75  green anole
Q6PBP2        84 SGASDEGEFTFQLTPERPGRPQ-LQLSYEKVQKDISFRLGVVDLQPVPEPTEVIRELITHGLEQSSRLQASNQHLLEENQ 162 zebrafish
XP_005996715  76 LGAKRTENYCFDFSKDGSKPDV-LQFSYEKLLKDVSFKLGSMELTIVSNPTEVIKELINYGLDCTAEERARNEHLQKENE 154 coelacanth
XP_015216180  77 ERSQEPVRYSFHVSRDGLETGA-LLLSYDKVQKEISFKLGSVELHAVAEPIEVIKELISHGLEHSTELQARNQHLQEENE 155 spotted gar
XP_014328982  77 -EPELSASYCFTLKPHPPTSSCtVTLTYEKMQKGISFKLGSVLLDAVEEPAEAVRAVLIHTLQQGNKLQQHNHKLKEENQ 155 southern platyfish
NP_001106551  76 MTTLPANKYNFDLLEDEENPEI-YHFTYEKKLKEVAFKLGSTKLKNVQNPAHVIRELINYCLDCTSELYSRNEHLQKENE 154 tropical clawed...
XP_003759919  78 LRTEPANVYKFDFSKENC------HFSYEKSLKDVSFILGSLNLQKVSSPAEVIRELMSYCLDCMADQLAKNRHLQRENE 151 Tasmanian devil
Q5XI44        76 PESGAAGAYKFIFSKDTQ------HFSLEKELKDVSFRLGSFNLDKVTNPTEVIRELICYCLDTIAEKQAKNEHLQKENE 149 Norway rat
NP_001075084  76 SGAGPTDTYKFNFSKESH------YFSFEKNLKDVSFRLGSFKLEKIASPAEVIRELICHCLDTIAESQAKNEHLQKENE 149 cattle
XP_015136170  76 LGEESAGKYNFTVSVDEENAQC--HFSYERNLRDGSFRLGSLKLQKVPCPADVVRELIGYCLDCLGGLQVKNEHLQKENE 153 chicken
XP_008101212  76 TEGIPSNIYNFDISKEGTNGDC-LHFSYEKKLRDLSFRLGSLKLQRIPSPTEVISKLISCCLDFIVGLHAKNEHLQRENE 154 green anole
Q6PBP2       163 KLRREQQHITEEMERYVKGKEALERDLYSRFVLVLNEKKAKLRALQqrvreleEAEEERSPRKKKAdsedheaveAAADK 242 zebrafish
XP_005996715 155 RLQSDWSYIMGELEKCVKAKEELEQDLYARFILVLNEKKRKIRQLR-------ASQQSSSGDRADM---------ATAQR 218 coelacanth
XP_015216180 156 KLRREWEYVTGELEKYVQAKETLEGDLYTRFALVLNEKKAKIRSLQqklnhlqGDMESVNVPRRDT---------ATVER 226 spotted gar
XP_014328982 156 RLIQEHQYITEKLKHYADGVETLKAELYSRFILLLNEKKTKIRNLQealtklqERRNSEEQKNKNS---------AKSDE 226 southern platyfish
NP_001106551 155 RLQCDWNDMHAQLEKFVNGKEELERDLYTRFTCVLNEKKAKIRSLKek---llESQERLKQKSEET---------APDDT 222 tropical clawed...
XP_003759919 152 MLQRDWSDVQKRLEECVTAKENLEADLYKRFVLVLNEKKGKIRSLHkllkqaqQPEKDTQDERESV---------DDIQS 222 Tasmanian devil
Q5XI44       150 RLLRDWTDVQGRFEKCVSDKEALEADLYQRFILVLNEKKTKIRSLlse---vqQLEKSTKPERETP----------SSDK 216 Norway rat
NP_001075084 150 RLLRDWNDIQGRFEKCVSAKEAVETDLYKRFILVLNEKKAKIRSLHkllnevqELEKNIEHKMETP---------TCSEM 220 cattle
XP_015136170 154 RLFCDLSDVEKRLEKCVEAKEELEGDLYNRFVLVLNEKKMKIRNLQkllneakESAVDTHCARDSI---------ATTQM 224 chicken
XP_008101212 155 ILLNDLNEVQDQLQKCVEAKEELETELYKKFILVLNEKKAKIRNLQkclkeaeETAVKATQARVVP-------------- 220 green anole
Q6PBP2       243 SPDEESDYG---GSTEDEQEAEPKrldpkpPTEEMPECSPMDDSL----NDITDVAPCRKRRHRHLQQLEAQAKRKTLEQ 315 zebrafish
XP_005996715 219 ASATEEDYG---GSTDEESKDSDSesnshpRPSTSANAVHKTISTdnspHDTFDIAPSRKRRQRLPKTHSTEKKKAAVEE 295 coelacanth
XP_015216180 227 KNPEEPDYE---GTTDEENEENNAcsqssaSARDKPGLSSLDVSL----NDTIDVAPSRKRRQRHVRGQESDAKKGSKEG 299 spotted gar
XP_014328982 227 TADHNSEADeygGSTDEEQSTGTS------HPSSKDSATPSPLNL----RDITDVAPCRKRRFRHLGP--PELAVKTQDP 294 southern platyfish
NP_001106551 223 LVAKEMKYDafaGSTDEEQESPAV--------ASKTAAASRRRSLvsyiDDAPDVAPSRKRRQRGQKTFYTDEVANTSKA 294 tropical clawed...
XP_003759919 223 QKKREAAYD---ESTDEESENLPV------PSKAVPANFSQNDSIis-sPDVTDIAPSRKKRQRLQKKVDTEAQFVPQKP 292 Tasmanian devil
Q5XI44       217 IPEEDGLYD---GSTDEESG----------APVLGADTLDKDDSLfs-sPDVTDIAPSRKRRHRMQTNLGTEPKMAPQEL 282 Norway rat
NP_001075084 221 TTDRDAIYD---ESTDEDSEIPSN------PSVLTPATVRRDDSIis-sPDIPDIAPSRKRRQRMQKNLGTEPKVASQEQ 290 cattle
XP_015136170 225 ATEKENDYD---GSTEEESENLIQ--------SSLPSAPERRDSLlg-sPDVIGTAPRRKRRQRTVNSAGTEAKIATYET 292 chicken
XP_008101212 221 ESKAEEDYE---GSTDEESENLVE-------PSTSAPVKPKRDSLl--sPDIIDIAPNRKRRQRVRNTASTEPKVALYEA 288 green anole
Q6PBP2       316 QhrsrekpvEETKAATSRTS-SVPVKPANTAANL-DPDELFD 355 zebrafish
XP_005996715 296 E--------SSNPAPQKSGTcHAAGKSLETAKNIaEPEDLFE 329 coelacanth
XP_015216180 300 Qekg---rvESAPKTSDVSN-EAPQGSTNTASSApEPEDLFD 337 spotted gar
XP_014328982 295 EaaqkkradSSAASNQLQTPqRSVDATKAASAGPsEAEDLFD 336 southern platyfish
NP_001106551 295 AkeetqrcnPVPAKAVGT-TlSTEGTSSQTLINTpDPDDLFS 335 tropical clawed frog
XP_003759919 293 TlqekekpeSSQLQSSSKEPfSSENMSLETLKNS-SPEDLFD 333 Tasmanian devil
Q5XI44       283 PlqekerlgSSPPQTLKEEGtSAAKMSLETLRNS-SPEDLFD 323 Norway rat
NP_001075084 291 QlqekekldPPLPEMPKKDHgPAENMSLETLRNS-SPGDLFD 331 cattle
XP_015136170 293 EmlakekpdLSSQKSSGKH--SPDVMSLETLENTcEPEDLFD 332 chicken
XP_008101212 289 QkiskekvdSSKPKSSDKQv-SSKGMATEAGKNGgDPKDLFD 329 green anole
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap