Conserved Protein Domain Family
DUF1152

?
pfam06626: DUF1152 
Protein of unknown function (DUF1152)
This family consists of several hypothetical archaeal proteins of unknown function.
Statistics
?
PSSM-Id: 399549
Aligned: 26 rows
Threshold Bit Score: 246.749
Threshold Setting Gi: 506226035
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8TY61           17 VLGIGGGGDVVGACHTYRWIRE-GIEPerlVLGGLTWERAVVDPEPGPRSRDEIVGdVEWIHERIGILRGRARPRRGqef 95  Methanopyrus...
jgi:Igni_0640    12 VVGIGGGGDVAAAYCVSKWVESvGGKA---ILGSVVWERLVRDPLPGPLPLRELNN-AEAVGDHLWVADGDEYAIRG--- 84  Ignicoccus h...
jgi:Arcpr_1078   15 LIGMGGGGDAVSTLAVAEFFKLfDVEC---ICGGVVWERVTRDKKPGPLSVEEIDD-CKSINNCLAWINARSN------- 83  Archaeoglobu...
WP_013684152     12 lIGIGGGGDVVSAFVIGEMLKEyGIDY---ICGGVVWERFRRDPKPGPRSIEEIEN-AEVINECLAWMKGAK-------- 79  Archaeoglobu...
O29480           17 TFGIGGGGDIVSTIPVANFLGHfGFET---LHGSVVWDRIVVDPKPGPRPLEELVG-IERINETVGIANESTKT------ 86  Archaeoglobu...
CGB:Asulf_01897  17 VFGMGGGGDIVATVPTANLMREfGFEV---LHGTIVWDRYIIDPEPGPRAIEDLEN-VEIVNDTIAIASEKTR------- 85  Archaeoglobu...
WP_023553513      5 FIAAGGGGDPIGTALTHASLGSdAd----aVVLTYAWERLTVDPLPGPLAPHDFAG-LDRDTLPVPLVTAGSKPVGQ--- 76  Streptomyces...
Q82F06            5 IVAAGGGGDAVAAATVDAALYGdGdr---aVILTYAWDRLPIDPVPGPRGPDQFTG-LEAITPAVRAVPAGARPIAP--- 77  Streptomyces...
WP_014442394      5 LVAAGGGGDAIAAAALSALIPDkAVG-----IATMAWDRLLIDPLPGPRSAADFAR-LES-RRGWWQVTSHSRPIAP--- 74  Actinoplanes...
WP_012933331     23 AIGIGGGGDVVGALAVAECARAlGGEA---VVGGVSWERRPIDPLPGPRRLDEVRG-AEQIHPAVALAGPDTTGPGGfhf 98  Conexibacter...
Q8TY61           96 AESRVRRVLRRMGHRDVEIVLVDVSGGVKGTVDGLKALIEHFELDVVFGIDVGGDALARGDEPGVESPLADSIMTCSLSK 175 Methanopyrus...
jgi:Igni_0640    85 GVRVVPQASILARVTGKRVYLFDLNGGAEGIKRGLKEAIELAGADLLIAVDAGGDVLARPEDEEVWSPLADSICLAAVKE 164 Ignicoccus h...
jgi:Arcpr_1078   84 YRGLKLIVAQVAEFLDCEVVGVDITKGERGLTESLKDFIERENVDLVVGVDAGGDSLARGNEKGLHSPLADAIVLASLNK 163 Archaeoglobu...
WP_013684152     80 IGRLKPIVAEVAEIAG-NAVGVDITKGVARLTRSIREFAREEDIEIIIGVDAGGDALARGSEKGLVSPLSDALMIAALSP 158 Archaeoglobu...
O29480           87 ADGVIPNIAKAAKHFG-KVVALDLTKNVGKLAEGIRDFAEKEGISLIVGVDAGGDAISVGFESGVRSPLADAICVAALKK 165 Archaeoglobu...
CGB:Asulf_01897  86 IGEIIPTVARAGRCLG-KVVALDITKGPKRLAEGLKAFMDENNIAIAVGIDSGGDVLASGFESGVRSPLADAISLATLSL 164 Archaeoglobu...
WP_023553513     77 RGSTLPRLA---GDLPTRLGLLDPYAGVEGLADQIGRTARALGAGHISVVDMGGDILAHGDEPTLVSPLPDALVLASCRL 153 Streptomyces...
Q82F06           78 AGSTLPRLA---AQLPHTFALIDPHHGAEGITRQLEELVSHFAPESIDLLDVGGDILARGDEPTLRSPLADALTLAACCQ 154 Streptomyces...
WP_014442394     75 AGSTLPRLA---GELPLPLALLDPSRGAQGMREQIESAARDLHADHILLVDVGGDLLGQPDDPGLRSPFADALTAASCLS 151 Actinoplanes...
WP_012933331     99 AE------SHMARLLGEPVVLIDPNPGPAAVADGLRVAAQRLSCDVVVLADVGGDVLAHGHEPGLASPLCDAVILAAAPL 172 Conexibacter...
Q8TY61          176 LEE---TVLGVFGWGSDGELTREELRRRFSEIAAEGGYLGAIGLTGRDVKFLKKLAEVVETEASLIPLRAAvEGELGPLE 252 Methanopyrus...
jgi:Igni_0640   165 IEIe--SWVAVFGPGCDGELPPQKVLERVSEAWRRGGNKGGFVLSKDDAEDCLKVVNEMHTEASKMGILAA-LGEFGEKK 241 Ignicoccus h...
jgi:Arcpr_1078  164 LN----SIVAVVGFGSDGELSRNELELYLSEIARLDGVLGASLITRDFADRIADFVENVYTTASKIPIIAS-QGYYGKFK 238 Archaeoglobu...
WP_013684152    159 LN----SIVAVVGFGSDGELSRKEIEGYLSELAANGGLIGAILIDRKTASRIYPLVERIETEASRVPLLAA-LGYNGVYT 233 Archaeoglobu...
O29480          166 VG----GIVAVTGFGSDGELRVEELLLNISDIIKKGGFLGCCSMSRRDYELMRNAVKDVTTEASMIPLMAF-EGEMGLKK 240 Archaeoglobu...
CGB:Asulf_01897 165 IEN---SFIGFFGFGSDGELRIEELLMKVSSLIKENMFLGSVSMSDEDYREMMELTKNVVTEASSIPLRAY-EGELGVLR 240 Archaeoglobu...
WP_023553513    154 AGIp--ATVHIAGPGLDGEVPEATLLTRFADDGNDLGRT-IPEWAAN-------IFRWHPSEASTLLAAAA-AGLRGPCL 222 Streptomyces...
Q82F06          155 VNAp--VRLLVAGPGLDGELPLDDLRGLLGPL--------VRTLTAKDVEPIGSVLEWHPSDAAGMLAATA-RGVRGACE 223 Streptomyces...
WP_014442394    152 LP----AEAWVAGPGLDGELTENLVWQRAASHAT------VHTLEPEIWKPYLPILHWHPTEATALLASAA-LGLRGTVE 220 Actinoplanes...
WP_012933331    173 LEPhvrTVGALFGAGCDAELTPAEVLERIAEVSAAGGLLGAWGLTPPAVERLAAAVEAVPTEASAQAVACA-RGAFGPIP 251 Conexibacter...
Q8TY61          253 IRGGYRTVELGPASVCTFYFDP-EVVarGSILCELV--DGTESVEEAHERIRkELGIKTELDWERERA 317 Methanopyrus kandleri
jgi:Igni_0640   242 IRRGSRTLFLSPLTATTFFLDS-NSI--DSVMAEAV--RGSVDIEEANQALR-ALGVYTELDLERDVV 303 Ignicoccus hospitalis KI...
jgi:Arcpr_1078  239 VWDK-AVIDVSILNALIFYVKT-DVIyrLSELPKAV--EGTVSVWVANERLH-EIGIKTELDHEIEVF 301 Archaeoglobus profundus ...
WP_013684152    234 IWDG-YEIEVSILNALAFFIDA-KKLyeLNPMAKAV--KGCNSIQEANEALH-RIGIKTELDIELELA 296 Archaeoglobus veneficus
O29480          241 LRKG-RSALVTPLSTLIFYFRA-EAVfeINHAAKIV--ERAETFEEANSLLH-AEGILTEYDFERAVA 303 Archaeoglobus fulgidus
CGB:Asulf_01897 241 VRAE-RSVPVSPLSIMTFYFKT-EGVfkMNKLAKTV--LDVESIDVARKRLN-EMGIFTEMDFEYLVK 303 Archaeoglobus sulfatical...
WP_023553513    223 TREGAGPIPLTGHSGRVWDLPL-ARAldHNRLAQGLlaARPHTLADAEDVSL-RLYGFNEVERERRRA 288 Streptomyces roseochromo...
Q82F06          224 VRDAGPPVPLTDEGPTLHEVDV-DEAvgRNRLARAI--METESLDEVEAHSR-EIRGCSEIDHERDQA 287 Streptomyces avermitilis
WP_014442394    221 IRDAGLPVPLTDRSPTALDLDL-AAVadINPLLPIL--AGTTSLAAAERLAV-RTMGTTELEAERAKA 284 Actinoplanes missouriensis
WP_012933331    252 IRQGRRTVERTPVGALTFYFEPaAAIasAARCAAAV--LGADDMLAAQAQLS-AAGIRTELDYERDAA 316 Conexibacter woesei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap