Conserved Protein Domain Family

pfam06618: DUF1148 
Protein of unknown function (DUF1148)
This family consists of several Maize streak virus proteins of unknown function.
PSSM-Id: 115288
Aligned: 2 rows
Threshold Bit Score: 206.465
Threshold Setting Gi: 81923479
Created: 11-May-2020
Updated: 6-Aug-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q77B23  81 TWWCWYIRDRVAPIHSLSTKYQLLRGSALASLQN 114 Maize streak virus - Reunion [SP2R12]
O73470  81 TWWCWYIRDRVAPIHSLSTKYHLLRGSALASLQN 114 Maize streak virus - Reunion [SP1R10]
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap