Conserved Protein Domain Family
DUF1147

?
pfam06615: DUF1147 
Protein of unknown function (DUF1147)
This family consists of several short Circovirus proteins of unknown function.
Statistics
?
PSSM-Id: 115285
Aligned: 3 rows
Threshold Bit Score: 89.3366
Threshold Setting Gi: 81982036
Created: 20-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O92288  1 MYTSLWGHLGVVKANGLLILQTRKPHTGNHLKTSGGMVTMVKKWLLLMTFMAGCRGMIY 59  Porcine circovirus
Q9YQX2  1 MSTSLWGHLGVVKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMAGCRGMIY 59  Porcine circovirus type 2-B
Q9YQS9  1 MYTSLWGHLGVAKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMAGCRGMIY 59  Porcine circovirus type 2-D
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap