Conserved Protein Domain Family
TRI12

?
pfam06609: TRI12 
Fungal trichothecene efflux pump (TRI12)
This family consists of several fungal specific trichothecene efflux pump proteins. Many of the genes involved in trichothecene toxin biosynthesis in Fusarium sporotrichioides are present within a gene cluster.It has been suggested that TRI12 may play a role in F. sporotrichioides self-protection against trichothecenes.
Statistics
?
PSSM-Id: 115279
View PSSM: pfam06609
Aligned: 2 rows
Threshold Bit Score: 1208.35
Threshold Setting Gi: 74638377
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9C1B3   1 MTVVVPEEGLDLESQPDDRMRAKALATSAAELPDGYYRSPRIVASFAAFSMNVVATYFVLQASASALPNILQDVGQSENS 80  Fusarium sporotrichio...
Q8NII4   1 MTATVHEKGVDLESQPDDRLRAQALATTADELPEGYYTSPRVIASFAGFSLNVCATYFVLQASASALPNILQDIGQSENQ 80  Fusarium austroameric...
Q9C1B3  81 SLFSTLWTTGQAVSILMMGRLTDRFGRRPFVILTHILGLVGAIVGCTATKFNTLLAAMTMLGVAAGPAGASPLFIGELMS 160 Fusarium sporotrichio...
Q8NII4  81 GLFSTLWTMGQAVSILVMGRLTDRFGRRPFVIATHIIGLVGAIVGCTANKFNTLLAAMTLLGVAAGPAGSSPLFVGELMS 160 Fusarium austroameric...
Q9C1B3 161 NKTKFLGLLIVSAPVVATNgLSPYLGQRLAIQGSWRWIFYIYIIMSTIAVTLIIIWYYPPSFAQLHGKKVSKREELAKVD 240 Fusarium sporotrichio...
Q8NII4 161 NKTKFLGLLTVSIPTIVMS-AGPYFGQRLSIQGNWRWIFYIYIITSAIAVLLIVVWYHPPSFRQLHGKKARKRDELAKLD 239 Fusarium austroameric...
Q9C1B3 241 WIGIILVIAGTSLFLLGVSWGGQPNNPWNSAKVIGLISSGAGTLVIFALYEVYGKPERPMVPPSLFKDTRGFVCILIISS 320 Fusarium sporotrichio...
Q8NII4 240 WIGIFLVSVGVSLFLLGVSWGGKPNSPWNSSKIIGLMTSGLGSLVVFALYEVFGKPVQPIIPPALFKDTRGFVCILLISS 319 Fusarium austroameric...
Q9C1B3 321 IMGSMHLSLVIMYPQQVVNIFGSSLKNWEETAWMSATASFGTGAGVVVLGSLFHLVRHIRWQILVGAMWLTAFLGAMSSI 400 Fusarium sporotrichio...
Q8NII4 320 IMGAMNLCLTIIYPQQVINIFGSSLKNWQETAWMTATASFGTWAGVMILGNVFHLIRHIRWQILVGALWLTAFLGAMSSV 399 Fusarium austroameric...
Q9C1B3 401 NRDNKNSAIALSVMTGFVVAWAQDITMLLVQFITTDENLGVAFAVVAAARPFAGSIFTAAFISVYTNRYPRELATHLSSA 480 Fusarium sporotrichio...
Q8NII4 400 NRDNKNAAIALSFFSGFVVGWAQDITMLMVQFITTDEDLGVAFSVVAASRPFFGSIFTAAFISLYSNQYPKEIGSHLTSA 479 Fusarium austroameric...
Q9C1B3 481 LRGTGFPQGSFSSLLEAAKSGRMEAVNALPGMTTEISSVVSQAMADSYTASYANVYYFAMALGVIPIIASLCMRDLDCYL 560 Fusarium sporotrichio...
Q8NII4 480 MRGTDIPQASFPSLLEAATTGRIDAVKALPGMTNSIAAVVSRAMADSYTASYANVYYFAMALGVIPIIASLCMRDFDRYL 559 Fusarium austroameric...
Q9C1B3 561 TDHVPHQLYDRKNAHKDVLEGNSESQPSPIILSMADKE 598 Fusarium sporotrichioides
Q8NII4 560 TDHVPHQIYDRKKADKDVLDGDSDTPSSPTIHSTVEVK 597 Fusarium austroamericanum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap