Conserved Protein Domain Family
DUF1139

?
pfam06599: DUF1139 
Protein of unknown function (DUF1139)
This family consists of several hypothetical Fijivirus proteins of unknown function.
Statistics
?
PSSM-Id: 115269
Aligned: 3 rows
Threshold Bit Score: 436.62
Created: 22-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q91E17      1 MNYTLGDHYASMyrsaplEFDphdpEINlVNQEFDEDDYTDLDVNLLSDDLSRLNLIAT-RIKNAPEYTAEIFDSFDVPL 79  Rice black streake...
Q4VPH7      1 MEQNQNEEFLVY------EFD----QIN-VNADQQEVDLDDQSVVLSTYEFPSFYDMAVdAISKDFNSTHLIMEELDGVN 69  Fiji disease virus...
YP_956852   1 MDSERHYEYGSYsnshgiEFDpnhpYIDlINDDFDENDYLDLETLNLEADYDDVESLAL-RLKNAPDYTTEIFEKIDRIP 79 
Q91E17     80 PFAELLDQEIGEEWCDTSNFMDLRIVEDEnDFEFVSSHITRHLLIVLNSNPNVLWTSTCLLAKLSLIQHVNN-FDVINYW 158 Rice black streake...
Q4VPH7     70 VIYDIFDSEALEKWLDIDTYFELKPFPIE-RFELFNRLLLHQFQTLAYNRPRASWSTLRNQATQSVIEGFEDeFSDLPIQ 148 Fiji disease virus...
YP_956852  80 NFVYLFETEIIDNWNDYDLFADLRVTDTSdEFYTLSSMLTEHMQSIITLLPSILWPMVSQLTKSNVFQAADD-VNITNYW 158
Q91E17    159 EAMNRRWEIITDELKMGFVFRAFNLKSNQFEVVTKLLSDSLFCPGISVIGKLSMIPMLTVHSIPEYLDHWFRTDDFSSDN 238 Rice black streake...
Q4VPH7    149 GMHNESWECLAPELRICFMFRSFKIKPSILLQVSRILAGSLMFPGLNLIGKKSLLDMFNNYNVIEYLDHYFPTSKYDSDE 228 Fiji disease virus...
YP_956852 159 RLMDRRWDFIDEQLRVQFIFRAYDLRAYQNGRVSQILSNSLLFAGLNLIGKRSCIPINSNFSIPDYLDYWFPTDDYHSDN 238
Q91E17    239 FLSFIRFgEITVPKWKKVVVQFYLRQVFS--RVRTKV-------LIANTDVDYWYSLFMQTLIFESMLRTKTLIKKILNS 309 Rice black streake...
Q4VPH7    229 YLKFIRF-DLVPDEWKLIVVKHEFENSFRflNVHGKTeekpyhkAMRGPPPDQWYTLLRRKFIFRSLKYTKRLIRNLLDY 307 Fiji disease virus...
YP_956852 239 YLIFIKFnETKNSGWKKIVVQYYLRKVFS--KIRTGI-------LIAHIDVDFWYNVFMRTLVRKEMIHTKNLIKSVLNF 309
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap