Conserved Protein Domain Family
Clostridium_P47

?
pfam06597: Clostridium_P47 
Clostridium P-47 protein
This family consists of several P-47 proteins from various Clostridium species as well as two related sequences from Pseudomonas putida. The function of this family is unknown.
Statistics
?
PSSM-Id: 368996
View PSSM: pfam06597
Aligned: 6 rows
Threshold Bit Score: 581.768
Threshold Setting Gi: 123613872
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3SU92    55 TLGWDTVFAIRMTDVNKAIVKQKTTPPTFSVsnp---lgEGSSLSGNFAAWQLTTG------ADGENVNVLVPASSGTFI 125 Nitrobacter winogra...
Q88LC9   113 TNGWDTVSICRVSALNQRIALEKTYPANIDAg------vDSFSLKADFDAWSITTG------GDGRNVKVRIPFGSGTYK 180 Pseudomonas putida ...
CBG72875  85 TMGWDTVSAVRLTDVNRAILNNATTPKEWSAkipgstfsSPVEASGGFDAWRLTPG------GTGGNVLMKIPFHATLVV 158 Streptomyces scabie...
CBG72874  84 TLGWDTISAVALTDVNNAIAKYGTSPHAWDGtvrrtkfsPEVALSGQFEPWTLTTG------GTGSKVIMKIPFSAEVVI 157 Streptomyces scabie...
Q3SU91    40 TLGWDTVFAINLPHVNEALRQTGSAPGDFsqt-----fsSAYAIAGTFGTWQVTMG------GDGQDIYLLVPVADGTLD 108 Nitrobacter winogra...
Q3SU93    40 TFGWTLVNGLVEAEVNTAWA--ADQPAAVTEfsf--dlgDGISVSGTFGKVSIHDGgpqglqGSGRYLYLAMPLIKGVVT 115 Nitrobacter winogra...
Q3SU92   126 -FGGKN---YDLTGVTATAQYHLNVIPpn--aPPTKPTETGTKHNIVVSDQAPGP-----------NVSPVSVVFIDVPA 188 Nitrobacter winogra...
Q88LC9   181 gLNGKT---YQIQGMSADVYVKLSYFP-----APNPVSASDGTYELQVNTQATDP-----------DDPIAAVIALRDPN 241 Pseudomonas putida ...
CBG72875 159 -NPGKGetvYDIQGGSANVEVYLEYHT---------SSKDGNVKELKLQSSPGDSgkedrdgddakPLAMITHLDFDKPD 228 Streptomyces scabie...
CBG72874 158 -VDGEDktdYVVKGGTAGVEVDLAFDP---------------AQQLRVDTLPDDG-----------KLALVTDVAFVQPA 210 Streptomyces scabie...
Q3SU91   109 -FNGAT---YDIAGGLATVMINFDYVPgvpkaAPVPVDAKGVPHKLKTKTTTSDPa----------NEPIAAVVQFVFPE 174 Nitrobacter winogra...
Q3SU93   116 -RSGAS---ETVSPGTFVVQAPLAFSPpi--pASAAQTASGTQHVLGVDWTETAS-----------SPAIIDYLY----- 173 Nitrobacter winogra...
Q3SU92   189 STSAKwpdgMSIEAVKGlllaAMTTYLN-------ANIKDFTQTFAAVDLNIMADQG-TLQWLSPALTSYAFADGGTVEN 260 Nitrobacter winogra...
Q88LC9   242 NVLSG----IDQSVMRG----VLEDWLNq-----pENLKKFDTLFSTVLINNMGKESeEFKWLRATSMSYAYTDKNSEES 308 Pseudomonas putida ...
CBG72875 229 IKNp-----DEKAAVVRsltaLLGQWLNardsgdmSNLGRFDHVFATIDLNTAEAQG-ELSWLTPTTREYAYINGKDANS 302 Streptomyces scabie...
CBG72874 211 ---AGdmpdEDREWLNKtlkyLLEQWLNa-----pANLGQFQHVFTAVDLNSAEAMG-DLAWLVPTHTSYAYINGKNEDD 281 Streptomyces scabie...
Q3SU91   175 GSKASgntpINRALVQG----ALTQWFI-------DNLERFQHVFSTVNLAEKADKA-SFQWLKPSLTGYAYADGTKPEN 242 Nitrobacter winogra...
Q3SU93   174 -SGAGslgpVPSALLRA----GFGAWLQraa--adGKLPKLNS--ATVTINKTFS---GFSWLQLAQASYAYQGSGEDAP 241 Nitrobacter winogra...
Q3SU92   261 SFFGVLTLTSDIGRAeNLKHELAASAIPTNQR--SAFLISQQLFLREAIFPGLPHAFNNARTSDFRLVNNDTEIINNgsg 338 Nitrobacter winogra...
Q88LC9   309 SIFGVLAMTNERDST-GLPNQLPAVMLAADNN--ANFLISREIFVKYQLLAALPFIFEGTTEANFTLDAAGTSITAN--- 382 Pseudomonas putida ...
CBG72875 303 SYLGVLCMTENRDPG-MAAQELAPGAIITGAE--ATFTISIDRVLNKMIMPAVQHSF-----PDGAFVLTAGEIVSKg-- 372 Streptomyces scabie...
CBG72874 282 SYLGVLCMTENRDPG-NAPQELAPGAMLGDQQkwSGFTVSKDRFMHKMVLPGLQHHF-----PDAKLTVKNGVFTAEs-- 353 Streptomyces scabie...
Q3SU91   243 SLLGVLTTTQRRSIA-DLSHQIAPSAIPSGAQ--SGFLISAELFLKQSVLPGLPHAFKKASASDFQLINHGSEITLArgv 319 Nitrobacter winogra...
Q3SU93   242 GVLGIMGGTTSP----GAFHVLAPDVIPSGGS--AGVLIGSQAFVQDVLLPAATAAFDGASPDEFELLNDDTSISLKsgk 315 Nitrobacter winogra...
Q3SU92   339 KVELDSVKVGAIDYHPYIESFDLVINTTEFHTTMEVKVNISPGIDTYITINTWHGLKLEKKTNGKQTIGFSETRPYSATH 418 Nitrobacter winogra...
Q88LC9   383 DLKLDSVKFGAITYHPVAEKFDINFDESYIRTECKVRTDISPGVVAYTRIVTKQTLQLGVNDKGEQVMVYAMVGDPDVQN 462 Pseudomonas putida ...
CBG72875 373 EFSLDTVEAGGLKYHPKVTSFHFSVIGQTLQVEMDVHIPISPGIDGYATMKYRVQPTMSHNSKGEPNLAYEVVEESSQHW 452 Streptomyces scabie...
CBG72874 354 EFRMAEIDVDGDSYQPVATLFSVSVDYDRITTHMQLHIPVNGHIDGYAKIEYAIQPTLGQNSKGQACVTYRVVQQDLSQW 433 Streptomyces scabie...
Q3SU91   320 TVDVNDIDYGGTTYHPKMSSFNLVINDTEIVTNMVVDVDVSPGISVTIMMTNYQTLTLVTKTDGTQTLGYKATRPPRHTY 399 Nitrobacter winogra...
Q3SU93   316 TLKLPAAVVESGNYDLTVTQFSITLQDRQIVSFVEAKTEVEPGVTLYVDVTLYNGLELITKEDGSRTLNYTVTRAADASH 395 Nitrobacter winogra...
Q3SU92   419 RVHTAPGVIITEVIAGIIVSVVGLVVGKI---VDTLAKRIIIAIIVAIIAgiiTAIQLIITEVIAKGVAESMPEIDPLVQ 495 Nitrobacter winogra...
Q88LC9   463 TTDIATWVVITEAILGAIAAVATAVAGGVggkVMALIVGIIAALVVAIVS---IVIHVIIERVVAGGVTNNIPSIAPMVK 539 Pseudomonas putida ...
CBG72875 453 HT-VADWLEGVEIAVDIIVLVLASVAGALlarGMSLLVKVVIAAATALVAt-lPAIFEQIPLFNADKALDDLPGILAMVN 530 Streptomyces scabie...
CBG72874 434 TT--------TDGIFGDFELWLGKIADGLggmLRSVVGDIGLKVLGSILFggvFALMDGLEGMDVEKALDHLPTADSFAQ 505 Streptomyces scabie...
Q3SU91   400 VKHVAAWVKITTAILSVLVAVIGAVVAGP---GAALADAIIIGIIVAIIIgiiVGVELIIEDVIAKGVAEAMPSINPMIY 476 Nitrobacter winogra...
Q3SU93   396 RIHNSTGAIIGKVLMSVILTLIFSVSGAV---AKNLGDKIMLLILATVIKggiTAAQNILPDLLKNGVKVALPSIDEMIN 472 Nitrobacter winogra...
Q3SU92   496 TGTSPITWP-TQQSQFTITAVQL-NESVQLSG 525 Nitrobacter winogradskyi Nb-255
Q88LC9   540 VAANQVKWPfSEPDAFVLTDITY-SGALIFGG 570 Pseudomonas putida KT2440
CBG72875 531 AVTAPITW--ADAKTFNPKAAMI-NGGLQVGG 559 Streptomyces scabiei 87.22
CBG72874 506 DATLPIAW--TNADVLKPAQVRLhNGAFQLFG 535 Streptomyces scabiei 87.22
Q3SU91   477 AATDPVVWP-TAASSFTLTSAGL-NGALQFGG 506 Nitrobacter winogradskyi Nb-255
Q3SU93   473 TLESSVAWAgKNGKSFAASGAQL-NESVQISG 503 Nitrobacter winogradskyi Nb-255
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap