7JRO


Conserved Protein Domain Family
DUF1138

?
pfam06592: DUF1138 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1138)
This family consists of several hypothetical short plant proteins from Arabidopsis thaliana and Oryza sativa. The function of this family is unknown.
Statistics
?
PSSM-Id: 429021
Aligned: 19 rows
Threshold Bit Score: 121.752
Threshold Setting Gi: 168064458
Created: 27-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
7JRO_d         3 TKYIVSAILGSFGIAWVCDYYVSEKKIFGGSTPGTITNKEWGEETDKKFQAWPRTAGPPVVVNPITRQNFVVK 75 
Q38842         4 ATYIIGALAGSAVVAYVCDKVISDDKLFGGTTPGTITNKEWGAATEERLQAWPRVAGPPVVMNPISRQNFIVK 76  thale cress
Q2HIQ2         7 AKYIIGALIGSFGISYIFDKVISDNKIFGGTTPGTVSNKEWWAATDEKFQAWPRTAGPPVVMNPISRQNFIVK 79  thale cress
XP_019079760   3 SKYIIGSVAASFAVAYICDHSVSDGKLFGGTTTKTVSE-EWWEETDKRANAWPRTAGPPVALNPISRQNFIIK 74  wine grape
XP_004249268   3 TKYIVGSVLASFAVAYVCDVVIADKKVFGGTTPHTVANNEWWKETDKKFQAWPRTAGPPVVMNPISRQNYIVK 75  tomato
BAS89898      17 TKYIVGSVTASFAFAYVCGVYFADKKVLGGTTPRTVADKEWGKVTEEKLDAWPRVAGKPVSMNPVTRQNYVLV 89  Japanese rice
EES05404       3 TKYIVGSVAASFAFAYVCGVYVADRKVLGGTTPRTVATNEWWQETDRKFQAWPRTAGPPVAMNPIRRHNFIVK 75  sorghum
BAS79697       6 TKYIIGSVAASFAFAYVCEIYIAEGKLLGGTTTRTMATDEWGKETDKKFQAWPRTAGPPVVMNPVRRQNFIVK 78  Japanese rice
ACU13209       3 GKYIVSAILGSFGVAWVCDYYVSEKKLFGGTTPGTITNNEWAEETDKKLQAWPRTAGPPVVMNPISRQNFIVK 75  soybean
ERM98638      90 AKSIILAVVGSGVLAFTVDHFLADKKLFGGTTPKTMTSTEWWEETDKKFQAWPRTAGPPVVINPISRQNFIVK 162 Amborella trichopoda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap