Conserved Protein Domain Family
DUF1138

?
pfam06592: DUF1138 
Protein of unknown function (DUF1138)
This family consists of several hypothetical short plant proteins from Arabidopsis thaliana and Oryza sativa. The function of this family is unknown.
Statistics
?
PSSM-Id: 399532
View PSSM: pfam06592
Aligned: 18 rows
Threshold Bit Score: 118.675
Threshold Setting Gi: 1433414254
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015641509   3 GKYIAAGLVGSFAISYVCDHFIAEKKIFGGTTPHTVSDKEWWQATDKKFQAWPRTAGPPVVMNPISRQNFIVK 75  Japanese rice
KQK19796       3 fKCVVGATVASLGIAYVCDTAVSDKKIFGGTVCKTATDKEWQQATDAKLQAWPRTAGPPVIMNPISRQNFIVK 75  stiff brome
Q38842         4 ATYIIGALAGSAVVAYVCDKVISDDKLFGGTTPGTITNKEWGAATEERLQAWPRVAGPPVVMNPISRQNFIVK 76  thale cress
Q2HIQ2         7 AKYIIGALIGSFGISYIFDKVISDNKIFGGTTPGTVSNKEWWAATDEKFQAWPRTAGPPVVMNPISRQNFIVK 79  thale cress
XP_019079760   3 SKYIIGSVAASFAVAYICDHSVSDGKLFGGTTTKTVSE-EWWEETDKRANAWPRTAGPPVALNPISRQNFIIK 74  wine grape
XP_004249268   3 TKYIVGSVLASFAVAYVCDVVIADKKVFGGTTPHTVANNEWWKETDKKFQAWPRTAGPPVVMNPISRQNYIVK 75  tomato
BAS89898      17 TKYIVGSVTASFAFAYVCGVYFADKKVLGGTTPRTVADKEWGKVTEEKLDAWPRVAGKPVSMNPVTRQNYVLV 89  Japanese rice
EES05404       3 TKYIVGSVAASFAFAYVCGVYVADRKVLGGTTPRTVATNEWWQETDRKFQAWPRTAGPPVAMNPIRRHNFIVK 75  sorghum
BAS79697       6 TKYIIGSVAASFAFAYVCEIYIAEGKLLGGTTTRTMATDEWGKETDKKFQAWPRTAGPPVVMNPVRRQNFIVK 78  Japanese rice
ACU13209       3 GKYIVSAILGSFGVAWVCDYYVSEKKLFGGTTPGTITNNEWAEETDKKLQAWPRTAGPPVVMNPISRQNFIVK 75  soybean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap