Conserved Protein Domain Family
Phage_T4_Ndd

?
pfam06591: Phage_T4_Ndd 
T4-like phage nuclear disruption protein (Ndd)
This family consists of several nuclear disruption (Ndd) proteins from T4-like phages. Early in a bacteriophage T4 infection, the phage ndd gene causes the rapid destruction of the structure of the Escherichia coli nucleoid. The targets of Ndd action may be the chromosomal sequences that determine the structure of the nucleoid.
Statistics
?
PSSM-Id: 148289
View PSSM: pfam06591
Aligned: 2 rows
Threshold Bit Score: 247.635
Threshold Setting Gi: 75093107
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AFO10788   1 MKYMTVTDLNNAGATVIGTIKGGEWflGTP-HKDILSKPGFYFLV-SKLDGRPfsnpcVSARFYVGNQRSKQGFSAVLSH 78  Escherichia phage E...
Q7Y4P4     2 SKYLTRKDLLAVGGEVVAVVRNGEY--GSEvSKEFRSREGFYFFVkGSSDWRQ-----VAARFFVGRQRSKQGLDAILSH 74  Enterobacteria phag...
AFO10788  79 IRQRRSQLARTIANNNVPYTVFYLPASKMKPLTTGFGKGQLALAFTRNHHSEYQTLEEMNRMLADNFKFVLQAY 152 Escherichia phage ECML-134
Q7Y4P4    75 IRQGRSQLARTMGTNNIEYDVIFVSAKNMKPLTTGYGKGQLALAFTRNHSSEYQTLTEMNRLLADNFRFILQSY 148 Enterobacteria phage RB69
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap