Conserved Protein Domain Family
DUF1137

?
pfam06587: DUF1137 
Protein of unknown function (DUF1137)
This family consists of several hypothetical proteins specific to Chlamydia species. The function of this family is unknown.
Statistics
?
PSSM-Id: 368992
View PSSM: pfam06587
Aligned: 2 rows
Threshold Bit Score: 236.369
Threshold Setting Gi: 514661892
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EPJ18120   6 EKAPPFLKIKKLGVHKQITSPDRQFFNCHVDKSCMELHLSDANYACKEVLSKLSGHIHTQDLDKLMTFQGNGGLLNYQDC 85  Chlamydia psittaci ...
O84661    44 TPAPPFLKIKKLGVRKRIISPEKQLFYCTIDKSCMELHFSNTSLHCRELLSHLTGCLQTETAERAMFFRGTGGLLNYKDY 123 Chlamydia trachomatis
EPJ18120  86 SLNIYDCRFHVDPIHPDPQAPEERAVGGMKTLSLSLL 122 Chlamydia psittaci 01DC11
O84661   124 SLSVYNCCFSINTPDAELEMGKGMAEGGMKVLSLSLL 160 Chlamydia trachomatis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap