6F0X


Conserved Protein Domain Family
p31comet

?
pfam06581: p31comet 
Click on image for an interactive view with Cn3D
Mad1 and Cdc20-bound-Mad2 binding
This family is involved in the cell-cycle surveillance mechanism called the spindle checkpoint. This mechanism monitors the proper bipolar attachment of sister chromatids to spindle microtubules and ensures the fidelity of chromosome segregation during mitosis. A key player in mitosis is Mad2, and Mad2 exhibits an unusual two-state behaviour. A Mad1-Mad2 core complex recruits cytosolic Mad2 to kinetochores through Mad2 dimerization and converts Mad2 to a conformer amenable to Cdc20 binding. p31comet inactivates the checkpoint by binding to Mad1- or Cdc20-bound Mad2 in such a way as to stop Mad2 activation and to promote the dissociation of the Mad2-Cdc20 complex.
Statistics
?
PSSM-Id: 368986
View PSSM: pfam06581
Aligned: 4 rows
Threshold Bit Score: 492.176
Threshold Setting Gi: 611996487
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6F0X_P        10 SSAAVPDLEWYEKSEETHASQIElLET--SSTQEPLNASEAFCPRDcMVPVVFPGPVSQEGCCQFTCELLKHIMYQRQQL 87  human
Q9DCX1        13 SPAAAPNLDWYEKPEETHAPEVD-LETviPPAQEPSNPAEPFCPRD-LVPVVFPGPVSQEDCCQFTCELLKHILYQRHQL 90  house mouse
XP_006100650  10 SLTAAPGLEWYEEAEDTHAPHIElLDT--TAAQELPSRSESFRPRHgLVPVVFPGPVSQDGCCQFTCEFLKHVMYQRLQL 87  little brown bat
XP_007484042   8 hwaqLSELEGIEESEESCAPQREqLES--TSTHDPSSNPEHLCPGDsLVPVVFPGPVNSEGCCRFACELLKHIMYQRQQL 85  gray short-tail...
6F0X_P        88 PLPYEQLKHFYRKpSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLEDFFARTLVPRVLILLGGNALSPKEFYEL 167 human
Q9DCX1        91 PLPYEQLKHFYRK-VPQAEDTARKKAWLATEARNRKCQQALAELESVLSHLRDFFARTLVPQVLILLGGNALSPKEFYEL 169 house mouse
XP_006100650  88 PLPYEQLKHFYRQsSPQAEDMVKKKPWAITEASSRKCQQTLEELESVLSHLESLFARTLVPRVLILLGGSVLNPKEFYEL 167 little brown bat
XP_007484042  86 PLPYDQLTVFYSKpSPQAEDMMRKKA----ERSYRKFQQALLELEGILSHLESLFARTLVPRVLILLGGSALCPKEFYEL 161 gray short-tail...
6F0X_P       168 DLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSC 247 human
Q9DCX1       170 DLSRLAPFGVDQGLNTAACLRRLFRAIFLADPFSELQTPPLMGTIVMVQGHRDCGEDWFQPKLNYRVPSRGHKLTVTLSC 249 house mouse
XP_006100650 168 DLSRLAPSNVDQRVSTAACLRLIFRAIFMADAFSELQAPPLMGTIVMAQGHRDCGEDWFRPKLNYRVPIRGHKLTVTLSC 247 little brown bat
XP_007484042 162 DLARLALGRMGQSLSTSACLRRLFRALFMADAFSELKAAPAMGTIVMAQGHRECGEDWFRPKLNYQVPKRGHKLTVTLSC 241 gray short-tail...
6F0X_P       248 GRPSIRTTAWEDYIWFQAPVTFKGFRE 274 human
Q9DCX1       250 GRPSVPAMASEDYIWFQAPVTLKGFHE 276 house mouse
XP_006100650 248 GRPSIPVTAWEDYIWFQAPVTLKGFHE 274 little brown bat
XP_007484042 242 GGPPIPDSAWDDYIWFQAPVTLKGFRE 268 gray short-tailed opossum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap