Conserved Protein Domain Family
Churchill

?
pfam06573: Churchill 
Churchill protein
This family consists of several eukaryotic Churchill proteins. This protein contains a novel zinc binding region that mediates FGF signaling during neural development (unpublished obs Sheng G and Stern C).
Statistics
?
PSSM-Id: 399521
View PSSM: pfam06573
Aligned: 13 rows
Threshold Bit Score: 173.707
Threshold Setting Gi: 321461974
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KJE95266       1 MCRNCLKEDTPARGTTCLDTGAYLVNFKGCAQCQSFEfPREQDRkVDEDDEtGEETVTFTHVCKQCNHVIAEHNYTFEIE 80  Capsaspora owcz...
EFX73001       1 MCESCLKEEYPNRDRMCLDSGAYMANLKCCCKCQSNQ-VSVLNK-TISEDD-GIEVTVFEHACGTCQHIISIHNYKFWVE 77  common water flea
XP_002610724   1 MCQNCVNNVFPDRGHTCLENGSYLMNFASCAQCNKKEmIKIHNK-EETEED-QEQVITYQHVCQNCDHVIAEHEYRFCVE 78  Florida lancelet
XP_002115762   1 MCNRCVFTPFPDRGNSCLDTGSFFLNFKACSSCQKRTlIETCNKeSKEEED-QTEVIKYQHICPNCRHVIANHEYTFQVE 79  Trichoplax adha...
XP_003386737  17 MCKDCLKEICPNRGNVCLETGSYLLNYSGCASCKSLSfILIKEKnVAEEEN-GDETVTYNHTCNECGHLIASHEYTFTLD 95  Amphimedon quee...
ABN70841       1 MCRDCVKQQLPDRGNMCLDNGSYLWNFQGCKECGQKDpVKIVDRqTTEDED-GEETITYKHECVHCGHVVAEHEFTFRV- 78  starlet sea ane...
XP_003726593   1 MCGECVKSKCPDRGNICLDNGSYILNFAHCAECQKREpIKIAQRnVEVKDD-GEEVISYEHKCTHCCHVIAEHEHTFSIE 79  purple sea urchin
Q4T7L7         1 MCNECVQKEYPDRGNTCLEDGSYLMNYVGCASCHQRDfVLISNK-ATEEDD-GEEIVTYDHVCKNCDHVIASHEYTFSVV 78  spotted green p...
XP_012404211   1 MCGDCVEKEYPNRGNTCLENGSFLLNYIGCAMCNKRDfMLIANK-SMKEED-GEEIVTYDHVCKNCHHIVARHEYTFSVM 78  Tasmanian devil
Q9DFZ3         1 MCGGCVGTEYPERGTTCLEGGSFLLNFVGCARCGRRDfVLLGNR-AAGLHG-DDEIITYDHLCKNCHHLIARHEYTFSVV 78  chicken
Q66JD9         1 MCGGCVQEEYPDRGSTCLETGSFLLNYVSCVQCNKRDfVLIVNK-TAEEED-GEEIITYDHMCKNCHHVIAKHEYTFSVV 78  tropical clawed...
XP_005991558   1 MCRACVQREYPDRGKTCLENGSFLLNYVCCAVCSKRDfVLITNK-AIEEED-GEEIVTYDHVCKNCHHVIARHEYTFTVV 78  coelacanth
NP_001007381   1 MCTGCVQKQYPDRGNTCLENGSYLMNFVGCANCHQRDfVLISDR-TMVNED-EEEIVTYLHMCKNCEHVIARHEYTFTVV 78  zebrafish
KJE95266      81 DGYQEYTMECQLCGTADDTASVLPDDPRKAQ 111 Capsaspora owczarzaki ATCC 30864
EFX73001      78 GDYQEYEMDCALCGTAEDSISILPDDPRKAS 108 common water flea
XP_002610724  79 DGYQEYQMTCLLCGSGEDSISILPDDPRKEM 109 Florida lancelet
XP_002115762  80 EGYQIYGMECLLCGCGEATVSVMPNDPRKll 110 Trichoplax adhaerens
XP_003386737  96 EEFQEYSMNCALCGYGSDTVSILPDDPREKq 126 Amphimedon queenslandica
ABN70841      79 GDSQDYSMSCLLCGEGTDQRNIFPENQYRQN 109 starlet sea anemone
XP_003726593  80 GEYQEYAMYCMLCGVGSDTVSVLPVDPRKEM 110 purple sea urchin
Q4T7L7        79 DEYQEYTMLCLLCGKAEDSISVLPDDPRQSA 109 spotted green pufferfish
XP_012404211  79 DEYQEYTMLCLLCGKAEDSISVLPDDPRQMA 109 Tasmanian devil
Q9DFZ3        79 DDYQEYTMLCLLCGRAEDSVSILPDDPRQMT 109 chicken
Q66JD9        79 DDYQEYTMLCMLCGRAEDSVSVLPDDPRQMA 109 tropical clawed frog
XP_005991558  79 EDYQEYSMLCLLCGKAEDSISVLPDDPRQMA 109 coelacanth
NP_001007381  79 DDYQEYTMLCMLCGKAEDSISVLPDDPRQTA 109 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap