Conserved Protein Domain Family
DUF1131

?
pfam06572: DUF1131 
Protein of unknown function (DUF1131)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 429009
Aligned: 12 rows
Threshold Bit Score: 275.802
Threshold Setting Gi: 490357134
Created: 20-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004236907         24 SFSWSSLSPVSWFsSS--GLTVTAQGVGGVNNQTAMTETAISQGLDDKYTLRGGMQTEQGQIVKIFEGRKDDKTVIRLSG 101 Morganel...
CAL21628             29 GFSWSSLSPLNWF-SGsrSMQVTEQGVGGITASTLLTESDINAGLQGDYRLRSGMATNDGKLVSFYQALKEDQIKLVISG 107 Yersinia...
WP_010617554         39 sYHWSALNPFSWF-GS--SLTVTEQGVAGLNSNTAMSESAISAALNNDYRLRQGMRTQNGQVVDFWQALDDGKVKLVING 115 Plautia ...
wugsc:CKO_00355      13 SVNWSAANPWNWF-GS--STEVTEQGVGALTASTPLDEKAITDALDGDYRLRSGMKTQNGNVVRFFEAMKEDKVALVING 89  Citrobac...
wugsc:KPN_02775      23 AVNWSAAYPWNWF-GA--STEVTEQGVGKLTASTPLNEQAISDALGSDYRLRSGMKTDKGNIVHYFEALKNNSVALTING 99  Klebsiel...
goetting:EBL_c10920  23 NAHWA---PWNWF-GS--SLTVSEQGVGALTASTPLTQDGIAGAIGSDYHLRSGMKMADGSVVRYFEALKNNQLALVIEG 96  Shimwell...
Q7N6Z6               32 GFSWSDLSPISWF-GS--PLKISDQGVGEINALTAMNEEAIEKGLDGKYHLRSGMETKNGQLVTVFQAMDSDQLKIALFG 108 Photorha...
IEC:ABF-0016757      28 GFSWSSLSPFNWF-GH--RLAVSDAGVGDINARTPMLESVLNDALNGDYRLRGGMETRNGKLVSIYEALKDDSVRLEISG 104 Dickeya ...
Q6D8U1               26 NFSWSSLSPFNWF-GS--ALQVTDAGVGGINAGTPLSEGALQNALDGSYQLRSGMGTSNGQLVAFYQALDGKDVKMIISG 102 Pectobac...
AHG18925             22 NFSWSSLSPFNWF-GG--SIEVSGKGVGGINASTPMTETAISEGLNNNYRLRGGMATSNGQIVSYYQALDGDQVKLVITG 98  Chania m...
utah:Sant_1231       23 DLSWSSFSPFHWF-GE--SRKVSDQGVGDITAATPMTQSALEKALGGDYRLRGGMETRDGDIVSVYQALSKGQVKLTVYG 99  Sodalis ...
KFD18224             31 SMSWSAMNPLNWF-GS--SATVSDKGVGEITASTPLTETAITDALDGDYTLRSGMSMSNGKMLSFFQAMDGKDVKMSVSG 107 Rahnella...
WP_004236907        102 PENGTVQRIVANDADIRTEWDIKTGTLFSDIYPQAVaGACTLTTEfDDSAQVICRSPQTPRVSYVFRGTWNGPETLMPSD 181 Morganel...
CAL21628            108 QPKGQVERIDVMDKGIPSQWGVTIGTPFSDLYKKAF-GACHKGRG-DDVNQVECVAPESKHVSYLFNGNWHGPEELMPSD 185 Yersinia...
WP_010617554        116 --QRSVERIEVLDSEARSADGSKIGDAFSDKFSKAF-DNCKMVAG-LDVRDVECRAPGSQHIAYIYSGEWHGPAGLMPSD 191 Plautia ...
wugsc:CKO_00355      90 -DQGTISRIDVLDSDIPSQAGVEIGTPFSDLYSKAF-GNCQKATG-DDSASVECKAQDSQHISYLFSGEWNGPEGLMPPD 166 Citrobac...
wugsc:KPN_02775     100 -DNGAISRIDVRDADIKTASGVKIGTPFSDLYSKAF-GNCQKGSH-DNGAVVECQAEGSQHISYAFTGHWSGPDELMPSD 176 Klebsiel...
goetting:EBL_c10920  97 -DKGQLSRVVVLDKTIPTESGVTLGTPFHELYSKAF-GACEKASG-DDEALVACKAPDSQHITYLFGGQWRGPQGLMPSD 173 Shimwell...
Q7N6Z6              109 QADGKVNRIEVLDEDIKTVWGTKVGMPFSALYSKAF-DVCRNAVSeSEKSAIVCVSPQSKHVSYLFTGNWNGPEGLIPSD 187 Photorha...
IEC:ABF-0016757     105 APKGQVTQVAVMDKAIASEWGVKIGDEFSSLYSKAF-GLCQPGQG-ADARSVECVAPQGKHVSYLFSGNWSGPEGLMPSD 182 Dickeya ...
Q6D8U1              103 QPKGSVSKVDVMDPAIDSAGGVKIGDAFSNTYSKAF-ESCQLGQG-DDAQSVECAAPQSTHVSYVYSGEWSGPEGLMPPD 180 Pectobac...
AHG18925             99 VPKGQVQRVDMMDPSIATEWGSQLGTPFSELFSKAY-GACKLGTG-EDEGNVECVAEQSRYVTYIFSGRWAGPQDLIPPD 176 Chania m...
utah:Sant_1231      100 PSSGRVAEVAVADDAIESAWGVKIGTPFSAVFQKAY-GACHKGSG-EDREAVVCQAPQSGHVSYVFKGIWHGPESLMPAD 177 Sodalis ...
KFD18224            108 EPKGNVQRVDVVDPKVESEWGVKIGTPFSDLYSKAF-DVCVKGEG-DDAENVECKAPQSAHVTYVFSGIWHGPDSLMPSD 185 Rahnella...
WP_004236907        182 DILKNWTVSYIVWA 195 Morganella morganii
CAL21628            186 DALQSWTVSKIIWR 199 Yersinia pestis CO92
WP_010617554        192 DTLKSWKISKIVWQ 205 Plautia stali symbiont
wugsc:CKO_00355     167 DTLKNWKVSKIIWR 180 Citrobacter koseri ATCC BAA-895
wugsc:KPN_02775     177 DTLKNWKVSKIIWR 190 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
goetting:EBL_c10920 174 DTLKNWTLNKIVWR 187 Shimwellia blattae DSM 4481 = NBRC 105725
Q7N6Z6              188 DVLKNWKVERIIWK 201 Photorhabdus laumondii subsp. laumondii
IEC:ABF-0016757     183 DILKSWKVSKIVWH 196 Dickeya dadantii 3937
Q6D8U1              181 DILKTWKVSKIVWH 194 Pectobacterium atrosepticum
AHG18925            177 DTLRNWTVSKIIWH 190 Chania multitudinisentens RB-25
utah:Sant_1231      178 DQLQTWQVSKIIWR 191 Sodalis praecaptivus
KFD18224            186 DALKDWKVSKIIWR 199 Rahnella aquatilis CIP 78.65 = ATCC 33071
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap