Conserved Protein Domain Family
DUF1131

?
pfam06572: DUF1131 
Protein of unknown function (DUF1131)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399520
View PSSM: pfam06572
Aligned: 16 rows
Threshold Bit Score: 270.747
Threshold Setting Gi: 490357134
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004236907         24 SFSWSSLSPVSWFsSSGLTVTAQGVGGVNNQTAMTETAISQGLDDKYTLRGGMQTEQGQIVKIFEGRKDDKTVIRLSGpe 103 Morganel...
ACR68448             22 SFSWSMLSPFNWF-SSGLYIDSNGVGGVSASTPMQQEVISQGLDGVYTLRSGMGIDNGQVTHFFQAMAQDKVAMTIAG-- 98  Edwardsi...
Q7N6Z6               32 GFSWSDLSPISWF-GSPLKISDQGVGEINALTAMNEEAIEKGLDGKYHLRSGMETKNGQLVTVFQAMDSDQLKIALFGqa 110 Photorha...
CBJ82256             36 EFSWSSLSPWEWF-GSALRVSEQGVGEVNKQTDMDQSAIEQGLKGKYRLRSGMETQNGKFVSIIQGMEGDQVKIELSGla 114 Xenorhab...
goetting:EBL_c10920  23 NAHWA---PWNWF-GSSLTVSEQGVGALTASTPLTQDGIAGAIGSDYHLRSGMKMADGSVVRYFEALKNNQLALVIEGd- 97  Shimwell...
wugsc:KPN_02775      23 AVNWSAAYPWNWF-GASTEVTEQGVGKLTASTPLNEQAISDALGSDYRLRSGMKTDKGNIVHYFEALKNNSVALTINGd- 100 Klebsiel...
wugsc:CKO_00355      13 SVNWSAANPWNWF-GSSTEVTEQGVGALTASTPLDEKAITDALDGDYRLRSGMKTQNGNVVRFFEAMKEDKVALVINGd- 90  Citrobac...
WP_010617554         39 sYHWSALNPFSWF-GSSLTVTEQGVAGLNSNTAMSESAISAALNNDYRLRQGMRTQNGQVVDFWQALDDGKVKLVING-- 115 Plautia ...
WP_013203317         38 tYSWSSLAPWHWF-GSSLTVEEQGVGTLNGSTAMTEEAISDGLNGNYQVRKGMRSDNGNVVTFFQAVKDAKVKVEVSG-- 114 Erwinia
AHG18925             22 NFSWSSLSPFNWF-GGSIEVSGKGVGGINASTPMTETAISEGLNNNYRLRGGMATSNGQIVSYYQALDGDQVKLVITGvp 100 Chania m...
WP_004236907        104 NGTVQRIVANDADIRTEWDIKTGTLFSDIYPQAVaGACTLTTEfdDSAQVICRSPQTPRVSYVFRGTWNGPETLMPSDDI 183 Morganel...
ACR68448             99 GVTVRRITVESAELATAWGTRVGTPFAALYTRAYdGECRRVAA--EEVTVVCRAPQSPRVSYQFRGEWGGPAGLMPPDDV 176 Edwardsi...
Q7N6Z6              111 DGKVNRIEVLDEDIKTVWGTKVGMPFSALYSKAF-DVCRNAVSesEKSAIVCVSPQSKHVSYLFTGNWNGPEGLIPSDDV 189 Photorha...
CBJ82256            115 KGKVNRIDVLDDRVKTVWGTRIGTPFSELYGKAF-GVCHRSSDfiMQPTVICIAPQSQHISYVFTGQWDGPEGLMPSDDA 193 Xenorhab...
goetting:EBL_c10920  98 KGQLSRVVVLDKTIPTESGVTLGTPFHELYSKAF-GACEKASGd-DEALVACKAPDSQHITYLFGGQWRGPQGLMPSDDT 175 Shimwell...
wugsc:KPN_02775     101 NGAISRIDVRDADIKTASGVKIGTPFSDLYSKAF-GNCQKGSHd-NGAVVECQAEGSQHISYAFTGHWSGPDELMPSDDT 178 Klebsiel...
wugsc:CKO_00355      91 QGTISRIDVLDSDIPSQAGVEIGTPFSDLYSKAF-GNCQKATGd-DSASVECKAQDSQHISYLFSGEWNGPEGLMPPDDT 168 Citrobac...
WP_010617554        116 QRSVERIEVLDSEARSADGSKIGDAFSDKFSKAF-DNCKMVAGl-DVRDVECRAPGSQHIAYIYSGEWHGPAGLMPSDDT 193 Plautia ...
WP_013203317        115 QSTVDRIEVTDSSIASADGNKIGTPFSDLFRKAF-GACQKGTGk-DSDGVECNAPGSQHISYVFTGEWHGPEGLMPSDEA 192 Erwinia
AHG18925            101 KGQVQRVDMMDPSIATEWGSQLGTPFSELFSKAY-GACKLGTGe-DEGNVECVAEQSRYVTYIFSGRWAGPQDLIPPDDT 178 Chania m...
WP_004236907        184 LKNWTVSYIVWA 195 Morganella morganii
ACR68448            177 LKSWTVSQIVWQ 188 Edwardsiella ictaluri 93-146
Q7N6Z6              190 LKNWKVERIIWK 201 Photorhabdus laumondii subsp. laumondii
CBJ82256            194 LKNWKISRIIWK 205 Xenorhabdus bovienii SS-2004
goetting:EBL_c10920 176 LKNWTLNKIVWR 187 Shimwellia blattae DSM 4481 = NBRC 105725
wugsc:KPN_02775     179 LKNWKVSKIIWR 190 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
wugsc:CKO_00355     169 LKNWKVSKIIWR 180 Citrobacter koseri ATCC BAA-895
WP_010617554        194 LKSWKISKIVWQ 205 Plautia stali symbiont
WP_013203317        193 LQKWTISKIIWQ 204 Erwinia
AHG18925            179 LRNWTVSKIIWH 190 Chania multitudinisentens RB-25
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap