Conserved Protein Domain Family
DUF1128

?
pfam06569: DUF1128 
Protein of unknown function (DUF1128)
This family consists of several short, hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399518
Aligned: 27 rows
Threshold Bit Score: 80.0161
Threshold Setting Gi: 148841345
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014643244  3 LEEPTRENLEFIINDMADRLQVVNRTIMDPDDYDLEKYDEIKELHDIVQMKGQLSVSEIQTFVQELGRFRK 73  Halobacillus halophilus
Q8ER04        3 LDQPSTENMKYILDTLAEELQIVNRSIMEVEDYNLDKYEDLKMMYEMVKTKGQLSALEKQAFIQELSSIRK 73  Oceanobacillus iheyensis ...
BAM47661      3 LSEANQKNLAYMLDSIGKQLDVANPSLLDPEDYNIDKYDDLKWLYDFVVNKNNISIAEKEAFIEELATIRK 73  Amphibacillus xylanus NBR...
Q5WFM7        1 MASLTLEEIETMLDDMKKKLNVVNASVITSDSVSPAKHDDLIALHAHVMRSPSFSISEMDEIVQELGQLRg 71  Bacillus clausii KSM-K16
Q5HN54        1 MSLSNEE----MISNIRQKLNIVNQALFNPEKFKSTPHQDISEIYEFVMSKDSFSPSEVTAIADHLGQLRQ 67  Staphylococcus epidermidi...
Q2FX13        1 MAMTNEE----KVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSEVTAIADALGQLRH 67  Staphylococcus aureus sub...
O35019        1 MSSPNTETLTQMIEEISQKLNMLNVGVIKAEDFSDEKIEDLTYLHRMVMKKESFSPSEMQAIAQELASLRK 71  Bacillus subtilis subsp. ...
A8FB03        1 MSEQKAAEVNQLIEDISQKLNMLNIGVIKAEDFSPDKYEDIEFLHQMVMKKSSFSPSEMQAIASELKNLRK 71  Bacillus pumilus SAFR-032
BAH45353      4 LNQPTVENLAIIIEGIKAKLNMANTAVMRPEDFDLVHYEDLLYLYNMVQKKAAFGINEMTAIVEELGAMRK 74  Brevibacillus brevis NBRC...
Q8Y6H7        3 LETPSQENLNFMLTEITTKLKMVNVGVFENLELDSVDYNALVDIYQLIKRKSTFSPREMQLFAEELRRVRK 73  Listeria monocytogenes EGD-e
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap