4ZSZ


Conserved Protein Domain Family
DUF1122

?
pfam06557: DUF1122 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1122)
This family consists of several hypothetical archaeal and bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399512
View PSSM: pfam06557
Aligned: 8 rows
Threshold Bit Score: 229.582
Threshold Setting Gi: 503541401
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4ZSZ_B         26 RKSQGRFKEEFNFDLSLGS-----KPLLTLKVFLGRkPYWQPWVEVFGVn-------pNLRNVFFGSEAERKLYEFLSEH 93  Pseudomonas ae...
jgi:Igag_1335  22 EKRHGRFVEEIAINICIERns-fkHYICFIKIFMGR-DLYRRWIEIFNIinni--sidGYTVNFYGTKIEQWLLDTASLW 97  Ignisphaera ag...
WP_013775477   15 DIKQTHIKELFYFKLYLGD-----KLVGYCNYFSGR-DYYPDWLEIDYYpwlr------------dvglEEEFFKKIYNF 76  Acidianus hosp...
Q4JCI2         16 DVKDTQIKELKTFILYVNG-----RKVGRTFYFTGR-EYYLPWIEIDYDpwlr------------eidgEVDLFNFIYNV 77  Sulfolobus aci...
Q96YU7         15 DIIQTHIKELKRFTVYVNN-----REVGLAFYFEGR-GYYLPWLEIDYTpwlr------------kegiEDEFFKFIYNF 76  Sulfurisphaera...
jgi:Smar_0130  29 RVWKGRFPEETNIEVFIEKdn-crNSLFHMKVFRGRlPLYRPWIEIHTIl-------sSACGVTFDGLVEDTVLDLLSIY 100 Staphylothermu...
Q9YBH1         45 SISQGRFSGEFFLAVRLERageklVELCNSLVFCGR-GVYRPWIEIFNVspslpvetdMPTA---GSPVEAALLDLAADA 120 Aeropyrum pernix
jgi:Tagg_1266  18 VVRKGRFPEEVNYEVYVGRge-awVRLLAVKMFNGRpPFYRRWVELFHIlpev--sfkGLKYVFLNSPQERELVKCLSSQ 94  Thermosphaera ...
4ZSZ_B         94 FG---RIFVEYFEDKETTYELQKGVPPALSRLGFELLKLGYTYFRDWFIPEGLMEGGHKIQAEKPKTAEAKARHLANLKK 170 Pseudomonas ae...
jgi:Igag_1335  98 LGpgeRIFIEYVNDIETRKQLERGYPVPVTRLGYELLRRGFTWFKDWYFPEGFMEGNPKIQGEKPLDRTVMERQLRDIRY 177 Ignisphaera ag...
WP_013775477   77 LSkrgRLFVTYDKDKETLDMIMKGYSAVDTPLGFSLLKAGFTWFKVWYFPEGGNEGSPKIQANKPLDENIAIKELEELLE 156 Acidianus hosp...
Q4JCI2         78 LPpggKLFVTYIRDKETADMLYQGFSPADTPLGFSLLKAGFTWFKNWYFPEGGNEGAPKIQANKPLNDTDMIRQLRELLD 157 Sulfolobus aci...
Q96YU7         77 LPaggKLFVTYVKDKETREMLLKGYSPVDTPLGFSLLKAGFTWFKDWYYPEGGNEGSPKLQANKPLSKDEEIRQLRQLLD 156 Sulfurisphaera...
jgi:Smar_0130 101 TGpggRVFIEYEWDPVTMRELEVDIPPAFTRLGYKLLVRGFTWFKDWYYAEGFMEGGRKLQAEKPVSPQRAKQHLQTLAS 180 Staphylothermu...
Q9YBH1        121 LGpaePLYVEYVWDRETLYQIQRGAPAPASRLGFELWKRGFRWFKTWYYPEGFMEGGEKLQAEKPLDREHESRLVAEARR 200 Aeropyrum pernix
jgi:Tagg_1266  95 LSggeKIFIEYIYDGETYKALEAGIPTPLTRLGYMLLENGFTWFKNWYFAEGFMEGSPKIQGEKPLDENHRMRLLQEICG 174 Thermosphaera ...
4ZSZ_B        171 EFE-EFIGKCED 181 Pseudomonas aeruginosa PAO1
jgi:Igag_1335 178 EVE-EFIRLVAS 188 Ignisphaera aggregans DSM 17230
WP_013775477  157 DVKsEKIKDWIN 168 Acidianus hospitalis
Q4JCI2        158 EVKrNEVKAFIE 169 Sulfolobus acidocaldarius
Q96YU7        157 EVKrEYVRKFIE 168 Sulfurisphaera tokodaii
jgi:Smar_0130 181 DAK-NLLEKGLP 191 Staphylothermus marinus F1
Q9YBH1        201 DLE-NFILAWEG 211 Aeropyrum pernix
jgi:Tagg_1266 175 EVE-DFLKTVGN 185 Thermosphaera aggregans DSM 11486
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap