1JOD


Conserved Protein Domain Family
Olfactory_mark

?
pfam06554: Olfactory_mark 
Click on image for an interactive view with Cn3D
Olfactory marker protein
This family consists of several olfactory marker proteins. Expression of the olfactory marker protein (OMP) is highly restricted to mature olfactory receptor neurons in virtually all vertebrate species from fish to man.
Statistics
?
PSSM-Id: 399511
View PSSM: pfam06554
Aligned: 8 rows
Threshold Bit Score: 258.917
Threshold Setting Gi: 15826766
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JOD_B        11 EXPLVLDQDLTQQXRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQqKLQFDHWNVVLDKPGKVTITGTSQNWTPDL 90  house mouse
1_pfamImport   2 ELTFRPDTHLTEVMRLRVQSLQQRGQGRQDGERLLRPNEAVYRLDFPRQ-ALSFSRWSAGPVQTGRLTITATSQLWTPDL 80 
XP_015197154   6 ELTFRQDAQLTEVMRLRVKSLQQRNQRPQDGEKLLQPQEVVYRLDFSQQ-NLRFLRWNVKLSAPGKITITGTSQLWTPDL 84  spotted gar
XP_005809367   6 ELHFRLDSQLTEVMRLRVQSLQQRSQKRQEGERLLRPNEAVYRLDFSKQ-SLRFSHWTVRLAQPGRLTITATSQLWTPDL 84  southern platyfish
XP_003227578   9 ELPLVQDVQLTQCMRLRVRSLQQKKEKPQDGEKLLQADEFVYRLDFSRQhGLRFLRWTVTLDKPGKVSIIGTSQLWTPDL 88  green anole
Q8QGU7         4 ELTFNPDVQLTEMMRLRVQSLQQRGQKRQDGERLLKSNEHVYSLDFSEQ-ALHFTCWNICISSPGRLNIIATSQLWTPDL 82  zebrafish
NP_001020356   6 ELTFTEDLQLTEVMRLRVQSLQQKGQKRQDGERLLLPHESVYRLDFSDQ-DLSFTRWNVSLQGTGRFTVTGICQLWTPDL 84  zebrafish
XP_006004323   9 ELAFTQDVQLTEYMRLRAQSLQQRNAKPQDGEKLLQPNEFVYRLDFLQQ-KLKFLRWNICLEKPGKIVITATSQHWTPDL 87  coelacanth
1JOD_B        91 TNLXTRQLLDPAAIFWRKEDSD---AXDWNEADALEFGERLSDLAKIRKVXYFLITFGEGVEPANLKASVVFN 160 house mouse
1_pfamImport  81 TNLMTRQLLEPVAVFWRSPGDSgaaAVRCYEADAHELGERIAESARVRKVMYFLFAFADGCGPQAVDCSITFT 153
XP_015197154  85 TNLMTRQLLEPAGIFWQKPGED---KVQCFEADAQEFGERIAELAKIRKVMYFLLTFEDGMSPADMNCSISFR 154 spotted gar
XP_005809367  85 TNLMTRQLLEPVGVFWRTAAEDa--PAQCYEADAAEFGERIAELAKVRKVMYFLFAFGEGCSPESVDCSITFM 155 southern platyfish
XP_003227578  89 TNLMRRQLLEPVAVFWKKPGSQ---EVECNEADALEFGERLVELAKIRKVMYFLLAYADGLEPAHLKCSVVFS 158 green anole
Q8QGU7        83 THLMTRQLLEPTGLFWRSADDE---NIQCYEADAQEFGERIAELAKVRKVMYFLFAFEDGLSPESVECSIEFQ 152 zebrafish
NP_001020356  85 THLMTRQPLEPIGQFWRNAGDPedsPIKCLEADIQEFGERIAELARVRKVMYFLIAFKEGATKEKISCSLTFC 157 zebrafish
XP_006004323  88 TNLMTRQLLEPEGIFWQEENKK---EIFNHEADVQEFGERIAELAKIRKAMYFLIAFKDGTEPANVKCSIVFK 157 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap