Conserved Protein Domain Family
DUF1118

?
pfam06549: DUF1118 
Protein of unknown function (DUF1118)
This family consists of several hypothetical plant proteins of unknown function.
Statistics
?
PSSM-Id: 368969
View PSSM: pfam06549
Aligned: 15 rows
Threshold Bit Score: 80.8985
Threshold Setting Gi: 122228669
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006842101  82 KLEKKKVLSNVEKLGFLSKAEELGFTLSSIEKLGFLSKAEELGLLSLVEQAAGFSPSALAASALPLSVAAVAAVVVIPDD 161 Amborella trich...
XP_002271953  78 NLEKKKVLSNVEKSGLLSKAEELGFTLSSIEKLGVFSKAEDLGLLSLLEKAASFSPSALASAALPIFVAAIAAIVLIPDD 157 wine grape
XP_006367071  75 KLEKRKVLSTVEKAGLLSKAEELGFTLSSIEKLGLFSKAEELGLLSLLEKSASFSPAALASAALPILVAAILTIVVIPDD 154 potato
EFH63815      83 KLEKRKVLSNVEKSGLLSKAEELGLTLSSLEKLKVFSKAEDLGLLSLLENLAGTSPAVLASAALPALTAAIVAVVLIPDD 162 Arabidopsis lyr...
CDM83289      75 KLEKRKVLSSVEKAGLLSKAEELGVTLSSLEKLGLLSKAEDLGLLSLVESAATVSPAVLASLSLPLLVASIATVVFVPDD 154 bread wheat
XP_005847850 121 RIQQLKLLSKLEQSGLLSLAEKNGVTLSKLEQSGLLSAAESLGVVSLLGDRNF--PGTLYALATALLVAGPASVYFLPDD 198 Chlorella varia...
XP_002975486  85 RIEQLRLLTKAEKAGLLSTAENLGFTLSSIEKLGLLSKAEELGVLSAATDPST--PGALLTTALALLLLGPAFVYFVPEN 162 Selaginella moe...
NP_001235602 101 RMEQLKLLSKAEKAGLLSAAEKFGFSLSTIERLGLLSKAEELGVLSAATDPGT--PRTLLTLSLGLLILGPLFVYFVPED 178 soybean
Q9SD79        45 RVEQLKLLTKAEKAGLLSLAEKSGFSLSTIERLGLLTKAEEFGVLSAATNPET--PGTLFTLSLGLLLLGPVFAYVVPED 122 thale cress
EEF47750      75 RVEELKLLSKAEKAGLLSAAEKFGLSLSTIEKLGLLSKAEELGVLSAATDPGT--PGALFSLSLGLLLLGPSCVYLVPED 152 castor bean
XP_006842101 162 SIALVAAQAVLAGALGVAAAGAFLGSVVLGGLQES 196 Amborella trichopoda
XP_002271953 158 SAALIAVQALIAGALVVGATGLVVGSVVLGGLQEA 192 wine grape
XP_006367071 155 SAGLVAAQAVLAGAFGLTAVGLFVGSVVLDGLQEA 189 potato
EFH63815     163 STTLVVAQAVLAGALALTGVVLLVGSVVLDGLQEA 197 Arabidopsis lyrata subsp. lyrata
CDM83289     155 STLLVTVQTVVATLFAAVAAGLFVGSVVLDGLQDd 189 bread wheat
XP_005847850 199 STALVAVQAVIALSCIAGGSAAWGGATLLSSLQKS 233 Chlorella variabilis
XP_002975486 163 SVPLVVLQAVVAAVSVLGGSAAFAASNFVATIQAA 197 Selaginella moellendorffii
NP_001235602 179 NLGLVGLQVVVALVSVIGGSAGLAASNFVSNLQKl 213 soybean
Q9SD79       123 YTWEVVIQVLVALLSVLGGSAAFAASGFVSNLQKS 157 thale cress
EEF47750     153 YPWEIVLQVAVALVSVVGGSAAFAASNLVSNLQKS 187 castor bean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap