Conserved Protein Domain Family
Vert_HS_TF

?
pfam06546: Vert_HS_TF 
Vertebrate heat shock transcription factor
This family represents the C-terminal region of vertebrate heat shock transcription factors. Heat shock transcription factors regulate the expression of heat shock proteins - a set of proteins that protect the cell from damage caused by stress and aid the cell's recovery after the removal of stress. This C-terminal region is found with the N-terminal pfam00447, and may contain a three-stranded coiled-coil trimerisation domain and a CE2 regulatory region, the latter of which is involved in sustained heat shock response.
Statistics
?
PSSM-Id: 399508
View PSSM: pfam06546
Aligned: 15 rows
Threshold Bit Score: 212.801
Threshold Setting Gi: 1034177652
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_023354524 193 YSGSNLYSSDSA-ANSGPIISD-------VT------ELAQSSPSASPSGSVDER-----IS-PMIRIKEE--------- 243 Tasmanian devil
3_pfamImport   1 --SSNLYSPDSSsANSGPIISD-------VT------ELGPSSPSASPGSSIDNG-----------RYAGE--------- 45 
XP_015212965 252 YTGANLYSADSP-VNSGPIISD-------VT------DVAQSSPSDTATEWSEER-----TS-PLVHIKEE--------- 302 spotted gar
XP_016811730 230 HSRTEGLKPRER-ISDDIIIYD-------VTddnadeENIPVIPETNEDVISDPSnc--sQY-PDIVIVEDdnedeyapv 298 chimpanzee
XP_003769453 230 HSRTEGLKPREQ-ISEDIIIYD-------VTddnideENAPVTPETNEDATSDTSnc--sQY-PDIVIVEDdneddyatv 298 Tasmanian devil
XP_012428115 256 lnRNEGLKQREQ-ISDDIVIYDvtedvgeEEhpmadeENTPVTPETSEDTTSDSSncscsYHsPDIVIVEDdnedeyapv 334 zebra finch
XP_014344336 242 YTGTKLYSSDSA-ENLGPIISD-------VT------DLAQSSPCVSPSASTREEr----SS-PVIRIKEE--------- 293 coelacanth
NP_001300665 244 FTGTGVFSSESP-VKTGPIISD-------IT------ELAQSSPVAT-DEWIEDR-----TS-PLVHIKEE--------- 293 zebrafish
XP_017945643 182 FADSSLYSPDSS---AGPIISD-------VT------ELAESSPSPSPCLSLEAS-----PS-PVILIKEE--------- 230 tropical clawed...
XP_009469632 212 YSGSNLYSPDSS-ANSGPIISD-------VT------ELAQSSPSASPSGSLDER-----SS-PVVRIKEE--------- 262 crested ibis
XP_023354524 244 -------------P----PSPPRSPQIEEISPSHPPSv------VETP----LSP------CTFIDSILQESEPSTAASV 290 Tasmanian devil
3_pfamImport  46 -------------P----PLRRKAPSLVPTSRACEAGg------TESR----ASPdniyssTSLVFQPFFRAEKAPLGLY 98 
XP_015212965 303 -------------P----DSPVHSPQVEEVSPATVa--------TDTP----LSP------STFIDSILRDSEASTT--- 344 spotted gar
XP_016811730 299 -----iqsgeqneP----ARESLSSGSDGSSPLMSSAvqlngssSLTS----EDP------VTMMDSILND--------- 350 chimpanzee
XP_003769453 299 iqggdkssdptsvP----ITDHESSVIESGSSLMSNAvqvnnssALTS----EDP------VSMMDSILNE--------- 355 Tasmanian devil
XP_012428115 335 iq-gdkntesvavPgndpA----SHVSDSTSPLMSSAvqvnnqsTLTA----EDP------VSVMDSILNENGvi----- 394 zebra finch
XP_014344336 294 -------------P----PSPAHSPQIEEVSv------------IDTGtescLSP------STFIDSILQENETSGSSNA 338 coelacanth
NP_001300665 294 -------------P----SSPAHSPEVEEVCPVEVEVgagsdlpVDTP----LSP------TTFINSILQESEPVSA--- 343 zebrafish
XP_017945643 231 -------------P----LTPSHSPEQSPAPPRv----------EDTP----VSP------STFIDSILQESEASVCPGG 273 tropical clawed...
XP_009469632 263 -------------P----PSPARSPQIE------------------------------------------ENEPSTTTAA 283 crested ibis
XP_023354524 291 sgtv--ggaiSPPPPGPLQTPEKCRSVACLDK--------------------------------NELSEHLDTMDSNLDN 336 Tasmanian devil
3_pfamImport  99 siftrkgtqgRPQCPPPVHLGAPCHALVCLFPp------------------------------rNELNDHLDTMDSSLDN 148
XP_015212965 345 ----------------QPPSEEKCLSVACLDNspqmsevscvfp--------spsslhprtqqgNELNDHVDNIDTSLEN 400 spotted gar
XP_016811730 351 -------------------------NINLLGK--------------------------------VELLDYLDSIDCSLED 373 chimpanzee
XP_003769453 356 -------------------------NINLLGK--------------------------------VELLDYLDSIDCSLED 378 Tasmanian devil
XP_012428115 395 -----------------------sqNINLLGK--------------------------------VELLDYLDSIDCSLED 419 zebra finch
XP_014344336 339 st-------sIDPSTAQSQPEERCLSVACLDSlvqspqmsevarlfp---spstsslhcrpqqgNDLCDHLDTIDSNLDN 408 coelacanth
NP_001300665 344 --------------LTPPPSEQKCLSVACLDK--------------------------------TELHDHLESIDSGLEN 377 zebrafish
XP_017945643 274 n---------KNEGVSQSNPPEPCLSVACLDNisssrqmsevsrlfptstcssssslqgrtdpgTELNDHVDSIDFSLDN 344 tropical clawed...
XP_009469632 284 ----------AGDSTTQPQPQEKCLSVACLDK--------------------------------NELNDHLDTIDSNLDN 321 crested ibis
XP_023354524 337 LQTMLTTHGFSVDTSALLDLFSPSMSVTDMSLPDLDSSLASIQDLLSSQEQP-KPLETE--TGGADSGKQLVHYTAQPLF 413 Tasmanian devil
3_pfamImport 149 LQAMLSTHGFSVDTSALLDLFSPSVTVTDMNLPDLDSSLASIQDLLSSQEQQ-KPSESE--DPSADAGKQLVHYTAQPLF 225
XP_015212965 401 LQTILNGQSINFDSSPLFDFFNSSMSTPDFNLPDLDTSLASIQDLLTQDQ---KATETT--EPSTDAGKQLVQYTAQPVL 475 spotted gar
XP_016811730 374 FQAMLSGRQFSIDPDLLVD--------------------SENKGLETTKNNVvQPVSEEgrKSKSKPDKQLIQYTAFPLL 433 chimpanzee
XP_003769453 379 FQAMLSGRQFSIDPDLLVDLFTSSVQMNPT--DYISNTKLENKGSETNKNNEvQPTSEDgkNSKPKSDKQLIQYTAFPLL 456 Tasmanian devil
XP_012428115 420 FQAMLSGRQFSIDPDLLVDLFTTSVQMNPTDHDHITNTKVETKGKETNKNNAdPAASQEmqGTKPRSDKQLIHYTAFPLL 499 zebra finch
XP_014344336 409 LQTMLSAQSFSMDTSTLFDLFNPSLPTSDMGLPDLDTSLDTIQDLLSSQEQ--KPTDTD--SNTADTGKQLVHYSAQPLF 484 coelacanth
NP_001300665 378 LQQILNAQSINFDSSPLFDIFSSAASDVDLD------SLASIQDLLSPDP---VKETES--GVDTDSGKQLVQYTSQPIV 446 zebrafish
XP_017945643 345 LQNLLNGQSFSVDTSALLDLFSPSLGIPDLPLPDPDSSLASIQELLSSQDQK-ASETVE--SRTPDAGKQIVHYTAQPLI 421 tropical clawed...
XP_009469632 322 LQTMLTTHGFSVDTSALLDLFSPSMTVTDMNLPDLDSSLASIQDLLSSQEQQ-KPTETE--ASTADTGKQLVHYTAQPLF 398 crested ibis
XP_023354524 414 -LVD----------SSTLDTT---GNDLPIFFEL-GEGPYFS-EGD----DYSD-----DPTISLLSGSEPTKAKDPAVS 468 Tasmanian devil
3_pfamImport 226 -LVD----------SGSVDVGcgvGGELPIFFEL-GEAPSFT-EGD----EFLE-----DPTASLFSGTEDPKPPDPAVS 283
XP_015212965 476 -LVD----------PSNAEIT---SGELPILFAL---------ENDfgtgEEGE-----DPTISLLSNDYQQKPEDPTSS 527 spotted gar
XP_016811730 434 aFLDgnpassveqaSTTASSEvlsSVDKPI-------------EVD----ELLDssldpEPTQSKLVRLEPLT--EAEAS 494 chimpanzee
XP_003769453 457 aFLDgsps--stveNGSATSEaasSLDKPL-------------GVD----ELLDssldpEPTQSKLVRLEPLT--EAEAS 515 Tasmanian devil
XP_012428115 500 aFLDgnpg--saveSGVFTAEtpsTVEKSV-------------EGD----ELLEssldpQPTQSKLVRLEPLT--EAEAS 558 zebra finch
XP_014344336 485 -LLD----------SGSGDMG---SGDLPILFEL-GDAPYFA-EGD----E-SE-----DPTIALLSSTDESKPKDPAIs 538 coelacanth
NP_001300665 447 -LPD----------PLSTDSS---STDLPMLLEL-QDDSYFS---S----EPTE-----DPTIALL--NFQPVPEDPKLS 497 zebrafish
XP_017945643 422 -LMD----------SS--------GSDLPILLELeGDEPYVAeEGD----DYSE-----DPTLSLLCW-------DPQSK 466 tropical clawed...
XP_009469632 399 -LVD----------SSAVDMG---SGDLPIFFEL-GEGPYFT-DGD----EYSE-----DPTISLLSGTEQSKPKDPAIS 453 crested ibis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap