Conserved Protein Domain Family
DUF1110

?
pfam06533: DUF1110 
Protein of unknown function (DUF1110)
This family consists of hypothetical proteins specific to Oryza sativa. One sequence appears to be tandemly repeated.
Statistics
?
PSSM-Id: 399500
View PSSM: pfam06533
Aligned: 6 rows
Threshold Bit Score: 187.762
Threshold Setting Gi: 9757661
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AACV:OsJ_00438   1 MAAE--AWRARFRERVVEAAG---RWERVREGLATALAH-VTSPMLAADEEAAAAARTRIQLAMGQLEDASRDLSSAMSL 74  Japanese ...
BAD61427             1 MAAE--AWRSRFRERVVEAAE---RWESVGESLATALTH-LKSPMHAGDEEEAAAARTRIQLAMGELVDASRNLASAMSL 74  Japanese ...
XP_015647353         1 MAAE--AWRARFRERVVEAASrmaRMERVQGHLAAAQGHlALAAPLLADNAAAAAARDRIQRVLGALGEASSDLAFAMSV 78  Japanese ...
Q5ZCD2               1 MAEE--AWRERFRQRVAEVDD---LFVEAFELLVDNARIhLEAQMLVGD--AAAAERARIQLAQGALEDASGKLASAMSL 73  Japanese ...
RCV24746             1 MAAEr-PWKAHVLGGVVSVGN---LCVNARDKLIYASPRcDEAPMRVAN---AQDARRRIHLLRDFLTDASGDLARAMGD 73  foxtail m...
BAB08180             1 MAEEenPWKPLFWWRVDAINQ---RVRVVREDLAAVEQQ---LASRVDKLSVASCAGDKL------LMEASRALGLAVCY 68  Japanese ...
WGS:AACV:OsJ_00438  75 MKAADLLALHGDSVNPSTFLGGI-GHLGAQYLAERIAVTKLREAWEDARDAYTNVEWCRSHLDAILLMLDHPHLP-SVDG 152 Japanese ...
BAD61427            75 MKVAELLALHGGSVNPSTHLGEI-SLLGDQYLAERNAGIKLLEAGKDARKAYISVDGCRGNLDAILLLLDHPRVP-CVDD 152 Japanese ...
XP_015647353        79 MNGAKLLVF--------SDVIGI-EQLGDQYFPEGNAGVVLHDSVEDVEEAFAMVDSCRSHLDAVLLLLDHPRLP-GVDG 148 Japanese ...
Q5ZCD2              74 MVGAKLLVLRGGSHDPLMPYHDI-GHLGDEYAAEKNACAKLRGAEREAEEACARIGMCSGHLETISLLLDHENLP-GVND 151 Japanese ...
RCV24746            74 MVAAEILSLQAAAADPRTPLVDV-QDIPDGDGDLRQALDTLRRARVSAERAYNYVQRCRGRLFTAALLLQFPDLP-DVDD 151 foxtail m...
BAB08180            69 MEAARLLARHRGGLIAQGRIPSRhGRVHDDDLAVRRALFYLRLAKARAEEACDALDRCRGHLGAVKMLLRRREAPaGVAD 148 Japanese ...
WGS:AACV:OsJ_00438 153 LIEEERA-AADGFLQAAIGRAELGNERAVDARQDVSG 188 Japanese rice
BAD61427           153 FIEEELF-VAGDNLQGAIGNAKLGTERAVGARQDVSG 188 Japanese rice
XP_015647353       149 LIQEELA-AADGDLQAAIGNAELGTELAVGARQDVSG 184 Japanese rice
Q5ZCD2             152 LIENERLdAAVDDLLAAIGKVESGKKMANDARLDVGA 188 Japanese rice
RCV24746           152 FIAVEQA-NAASSCEGATHLAADCTALITEACRflgr 187 foxtail millet
BAB08180           149 HVDGERA-SAVGDLEAA-------RQLMVDTDAFISA 177 Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap