Conserved Protein Domain Family
DUF1109

?
pfam06532: DUF1109 
Protein of unknown function (DUF1109)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399499
Aligned: 127 rows
Threshold Bit Score: 80.6582
Threshold Setting Gi: 504242894
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9A3F2        10 LAADAGRGTEPAPPRRLALVAGLGGVAALLLVLGWLQARPDLGQAILGPMFWVKAIYTGLLGLAGYLAVERLSRPGGS-G 88  Caulobacter vib...
WP_014893123  10 LTDNCAPIRPLPHPAWRALVWFAASLCYVAIVVAAMGVRPDFFHKIADPQFATEVAAAFLTSVVAAAGAFSAGCP----A 85  Methylocystis s...
WP_012319525  12 LSNNLPAVRSLAPAHRRALTWLLLAAPSVAAFVFLFSPRRDLAAKLDDWRFLVEQGATLATAILAAICAFAMTVPGR--D 89  Methylobacterium
WP_069297462  12 LVVSLAPVRRVRKRTGL-LVVAAATLLAIALSAPVFGLRPDLAAMNPAEIVLLRSGALLLTGIAAALAVTASASPGVGsR 90  Erythrobacter l...
Q1GPN6        12 LVGGLEPIRPLRFSSGLGFALA-GLGVTLGAVAWLFGFRTDVLAGNFDPVFLLAAGLFFLLGLATSATVVVMSRPHIGsD 90  Sphingopyxis al...
Q2N828        14 LTEDLQPVRAMKARDGLLLAALAGAITVLAVWLAA-DLWEGIAHGEASAFFFVTNGLLLVLGLAAVTATVALASPSVGnR 92  Erythrobacter l...
KZX52781      12 LVDDLEPVRPMKLAHGIGL-VALAALVTIGLVELLDGLWRGILAGEASAYYFIANGMLGLLGAAATLAVLRMASPRVGnT 90  Erythrobacter s...
EMD84607      12 LAENLVPVRPVQPARGMAI-VASAAAATMVLVAMFMGFRSDLFAGSMSAFFFITNGMIGLFGIAATLTVVRMANPRVGgG 90  Pacificimonas f...
WP_006833120  12 LAQDLAPVRPIRLSHGVAL-VALAAIGTVVLVELIEGLWRGILDGAPSTEFFMTNGMLGLLGAASAYAVLRMATPHVGnS 90  Erythrobacter s...
WP_037556950  13 LAGDLTPVRPRRVARG-SIWVAAGWVAGAAALLWIFGLREDLAVSGMPPLSMLAFWLTAATGLAATWSALRMGLPGVGrD 91  Sphingopyxis sp...
Q9A3F2        89 RRGWIIGAVVF-GACA-VAGIYQAITsPDVQAALKLLHGYSWRSCSPRILVLGLPMLALGLWALRGMAPTRPGLAGFAMG 166 Caulobacter vib...
WP_014893123  86 RPIWERLAAGLfFLLWaGALAVGCWR-DVDAFGVSGLFSHSDIYCLPTILAISIPAAVLILSMVKRGAPIAPFVTIGLAA 164 Methylocystis s...
WP_012319525  90 RRMALLPLVP--LAIWiGVLGDGCVRdVLAGVPSGLGFRADW-VCLPIIAAVGAWPAVLMLVMLRRGAPLTPHRTVAVGA 166 Methylobacterium
WP_069297462  91 REGWRWALGAM-LLFPaASGLLILGG---APYPLEILAASSVPYCIGLSLSSALAIGGLLTAWLRRGAVTELRRAGWLTG 166 Erythrobacter l...
Q1GPN6        91 HSGWRWAAAMT-ALLP-IAAILTSLE-RGRMAVSAADAGHGF-DCLVAGSALGLLIAAVLVWWLRRGAPTSPERAGLLTG 166 Sphingopyxis al...
Q2N828        93 QDAPRWALAMV-AILP-FTAVATVFA---AGSGPAALVDPYSLHCLTAATGASALTFVALTYWLRRGAPVSVETAGFFAG 167 Erythrobacter l...
KZX52781      91 QEGARWALAMF-ALLP-AVAAITLGL---QGRLQQIGADPYGLSCFLAGSGFSLLTFGALTAWLRRGAPVSPTRAGVYTG 165 Erythrobacter s...
EMD84607      91 NIGVAWAA----GMLF-VLPASLLAVyGPTAMLGRVGSDPHGIDCFLVSACAGSLTFAALVFWLRRGAPVSLRSAGQWTG 165 Pacificimonas f...
WP_006833120  91 HEGARWSAGML-TLLP-LTALVMLGF---GGFAAALTQDMYGLGCFVAGSAFGLATAAALTLWLRRGAPVSLKAAGTYTG 165 Erythrobacter s...
WP_037556950  92 YGGWRWAVGAS-LSLP-LAALVACIT-DGHAAMESARHGFGLR-CLLQGVASGLGVGAALFFWLKAGAPTSPTRAGWVIG 167 Sphingopyxis sp...
Q9A3F2       167 LFSGGVVATLYGLHCPEHTFTFLALWYSLGVLALGLIGGWAGRWLLRW 214 Caulobacter vibrioides
WP_014893123 165 LASTALAAAALRLSFRQDAAASVCIWQFGSVVLLTGVASLFGRALLHW 212 Methylocystis sp. SC2
WP_012319525 167 LAAAGLGNFGLRLFHQQDVSLTILVWQVGSTLALASLASWAGPRLLRW 214 Methylobacterium
WP_069297462 167 LAAGALGTFVYNLGCPSNSVHYVALWYGISVGSAALAGRLMVPPLLRW 214 Erythrobacter litoralis
Q1GPN6       167 IAAGSFGMFAFSLHCQYNDIIHIGLWHGLAVAATAGLGRLVIPRLIRW 214 Sphingopyxis alaskensis
Q2N828       168 IASGAIGSFAYGLSCPIDGVAHLGLWHVLPVAIAGLIGRTVLPPLIRW 215 Erythrobacter litoralis HTCC2594
KZX52781     166 IAAGAIGSFSYGLACPIDTLGHLATWHTLPVVLGAFAGRAVVPGLVRW 213 Erythrobacter sp. HI00D59
EMD84607     166 AAAGAVGSFAYGLACPFDSIAHLGVWHLAPLLLLAVIGRFAVPPLIRW 213 Pacificimonas flava
WP_006833120 166 IAAGAIGSFAFGLACPVDDIGHLGIWHVAPVVLSGLVGRFAIPPLVRW 213 Erythrobacter sp. SD-21
WP_037556950 168 IAAGAAGATIVALHCATDDVVHIALWHGAAVLLSAIAGRLVLPRFLRW 215 Sphingopyxis sp. LC363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap