Conserved Protein Domain Family
DUF1108

?
pfam06531: DUF1108 
Protein of unknown function (DUF1108)
This family consists of several bacterial proteins from Staphylococcus aureus as well as a number of phage proteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 368958
View PSSM: pfam06531
Aligned: 2 rows
Threshold Bit Score: 130.014
Threshold Setting Gi: 122539039
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2FWQ7   1 MYYKIGDVCQKVINVDGFDFKLAVKKQDYSILVNVLDLEDRFIDGINITDENDLYTALDILNQSIYEWIEENTDERDRLI 80  Staphylococcus aureus...
Q2FX31  21 MYYKIGEIKNKIISFNGFEFKVSVMKRHDGISIQIKDMNNVPLKSFHVIDLSELYIATDAMRDVINEWIENNTDEQDKLI 100 Staphylococcus aureus...
Q2FWQ7  81 NLVM 84  Staphylococcus aureus subsp. aureus NCTC 8325
Q2FX31 101 NLVM 104 Staphylococcus aureus subsp. aureus NCTC 8325
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap