2JRO


Conserved Protein Domain Family
DUF1107

?
pfam06526: DUF1107 
Protein of unknown function (DUF1107)
This family consists of several short, hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399495
View PSSM: pfam06526
Aligned: 21 rows
Threshold Bit Score: 79.1302
Threshold Setting Gi: 469771652
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JRO_A             2 RVFPVYAPKLIVKHARIFLTGVIWVKDLGRLEFEKGRFLL--PRKSLPKVKQAILELNELIEAQ 63 
jgi:Tola_1270      3 RSFREHQALKIAKYIRSYYRGSFYIDQSGPFHFDAGRACY--DDVENVKWKKILSQINKEIKKM 64  Tolumonas auensis DSM 9187
UNSW:PCNPT3_09975 10 RSFKKYHPRQIAKFVKGFFNGRIFIVGLGRLRVIEGRVVAyqYQKKQQNILIVVSEINQIITEM 73  Psychromonas sp. CNPT3
Q5E302             2 RFFKHYAPSMIAKHISRLFNGKIHIHGIGEFRFKDGQLVA--PTEAEREHYKMVKEINSEITRL 63  Aliivibrio fischeri ES114
WP_014292644       2 RIFNKYQPLLIAKYVKTFFKGRLYIHGRGAYSYARGVLIM--PEQADARHRETVSEINRLIGRL 63  Oceanimonas sp. GK1
WP_011705869       5 RVFKKYLPLMVAKHVKTFFKGRIYIHGRGRFDFQSGLLMM--PTSADIPHRQTVVEVNELISRL 66  Aeromonas hydrophila
jgi:Sama_3320     14 RVFPVYAPKLIVKHVRIFLTGAIWVKDLGRLEFEKGRFLL--PRKSLPQVKQAILELNELIEAQ 75  Shewanella amazonensis SB2B
jgi:Fbal_3666      2 RIFPLYAPRLIAKHARIFRDGVVMVKHLGMLEFRNGRFVM--PQRPLPKVRSAITELNEIltpa 63  Ferrimonas balearica DSM 9799
Q088P2             2 RMFPVYAPKLIVKHARIFLSGVIWVKDLGLIEFDKGRFLQ--TKKSLPEVKQAISELNALIEIq 63  Shewanella frigidimarina NC...
jgi:Tola_2182      2 RIFKKYFPALIAKYVRTFFRGRLYIHGRGGYEFENGKVVM--PPEADQVHRATVQELNHKIAEi 63  Tolumonas auensis DSM 9187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap