Conserved Protein Domain Family
DUF1106

?
pfam06523: DUF1106 
Protein of unknown function (DUF1106)
This family consists of several hypothetical bacterial proteins found in Escherichia coli and Citrobacter rodentium. The function of this family is unknown.
Statistics
?
PSSM-Id: 115195
View PSSM: pfam06523
Aligned: 2 rows
Threshold Bit Score: 179.054
Threshold Setting Gi: 75407612
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O85631   1 MASLWKRLFYSSGRRRRYFEEGEHSFSILCGRLRGIVLTIKCSNGIIYLSIKVSPNNRNHVFLYHKKDYVFDKLKEIFPD 80  Escherichia coli
Q93FK5  13 MASLWKKLFYFPGNRRRYFEQEEHSFSIICGRLRGIVVTFKCSKGIIYLSIKVNPNNSKHILLYNKKEYIFDKLKELFPD 92  Citrobacter rodentium
O85631  81 EAIEFTIEYEN 91  Escherichia coli
Q93FK5  93 EAIEFSIEYEN 103 Citrobacter rodentium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap