6FW4,3QDP


Conserved Protein Domain Family
TolA

?
pfam06519: TolA 
Click on image for an interactive view with Cn3D
TolA C-terminal
This family consists of several bacterial TolA proteins as well as two eukaryotic proteins of unknown function. Tol proteins are involved in the translocation of group A colicins. Colicins are bacterial protein toxins, which are active against Escherichia coli and other related species (See pfam01024). TolA is anchored to the cytoplasmic membrane by a single membrane spanning segment near the N-terminus, leaving most of the protein exposed to the periplasm.
Statistics
?
PSSM-Id: 399492
View PSSM: pfam06519
Aligned: 9 rows
Threshold Bit Score: 115.602
Threshold Setting Gi: 1016391965
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6FW4_A            1 AARQQFVTSEVGRYGAIYTQLIRQNLLVEDSFRGKQCRVNLKLIPTGTgalLGSLTVLDGDSRLCAATKRAvAQVNSFPL 80  Vibrio cholerae
Q8ZQT6          313 GANGGATGADISAYAKQIQVAIQSRLYDASLYQGKQCVLHISLAPDGS---LKSITSEGGDPALCQAALMA-AKTAKIPK 388 Salmonella e...
P44678          276 ALGSGDGGKVGDQYAGVIKKEIQRRFLKDPNFAGKVCRIKIQLGRDGT---ILGYQKISGSDDICSAALSAvARTKKVPA 352 Haemophilus ...
Q9CM70          293 ALGAGDGGKTGDQYAGVIKREIQRRFLKEPSFANKVCVVEVEFLRDGT---IANYRRVSGPDDICQAAVSAvARTKKVPP 369 Pasteurella ...
Q8EDJ7          247 QTMNKQMQTEVGKYTAMIKSTIQRNLVVDESMRGKTCTVSVRLANDGF---VISSQTQGGDPNVCRATKAAiLKAGKLPV 323 Shewanella o...
Q87QU0          256 QAQGKFVADEVSRYSSIYIQLIQSRLLKDDYLLGKECRVNIKLIPTGTdmiVSSVNVLSGDSRVCAAAKSAiAQVPSFPM 335 Vibrio parah...
3QDP_A           33 TKNNGASGADINNYAGQIXSAIESXFYDASSYAGKTCTLRIKLAPDGM---LLDIKPEGGDPALCQAALAA-AKLAKIPK 108 Escherichia ...
IEC:ABF-0015501 303 NKKSGASGAALDSYGSQVRTAIQSKFYDWESYKGRTCTLRIRLAPDGL---LVDVKSEGGDPALCQAAIAA-AKQARIPK 378 Dickeya dada...
KZC53318        293 GKKSGASGADISGYLGQITGAIQSKFYDADLYKGRTCDLRIKLAPDGL---LIDVKAEGGDPALCQAAIAA-AKQAKIPK 368 Yersinia pestis
6FW4_A           81 PKDQpDVVEKLKNINLTV 98  Vibrio cholerae
Q8ZQT6          389 PPSQ-AVYEKIKDAKLDF 405 Salmonella enterica subsp. enterica serovar Typhimurium
P44678          353 APSD-EIYEKYKSPIIDF 369 Haemophilus influenzae Rd KW20
Q9CM70          370 APTD-DIYQRYKKSPIEF 386 Pasteurella multocida
Q8EDJ7          324 SPDP-AVYNLMKEINLIV 340 Shewanella oneidensis
Q87QU0          336 STDS-TVNQRLKDINLTV 352 Vibrio parahaemolyticus
3QDP_A          109 PPSQ-AVYEVFXNAPLDF 125 Escherichia coli K-12
IEC:ABF-0015501 379 PPSS-DVYEAFKnapidf 395 Dickeya dadantii 3937
KZC53318        369 PPST-DVYEQFKNAPLVF 385 Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap