Conserved Protein Domain Family
NUP

?
pfam06516: NUP 
Purine nucleoside permease (NUP)
This family consists of several purine nucleoside permease from both bacteria and fungi.
Statistics
?
PSSM-Id: 399490
Aligned: 103 rows
Threshold Bit Score: 268.231
Threshold Setting Gi: 324025620
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EMR61995          1 MFE---------PEADIWYkNLPqsglgdlLAVNISVPGLSplyPQVHCTASGDICQMTAGESEINAATSLTSLVLgsss 71  Eutypa lata ...
WP_014403493     45 TFElgadtgdrpGEFQPWVeHEH-------LDQVLPFPGGV---HSLRSNASHDVLGVVSGMTLVNAGASLMALGL---- 110 Frateuria au...
WP_013572876     36 SFEigkdtgdipGEFQLWVeREH-------LTESLEFAGGV---HPILTNADHSVIGIVSGTTLVNATASVMALGL---- 101 Granulicella...
jgi:AciPR4_1025  74 Tt---------pNEFKLWGaREH-------LPETLDVPGVP---LPVHTNAEHTVLGMISGDTLINASASMMAIGL---- 130 Terriglobus ...
jgi:AciX8_4548   57 TFEvgkdtgdfpGEFQFWVeREH-------LTEIIDFPGGV---HPLRTNPEHTILGMVSGTTLVNATASMMALGL---- 122 Granulicella...
jgi:Terro_4265   34 TFEigkdtgdlpGEFQLWVeREK-------LTEIVEFPGGA---HPLRTNAEHTVIGMLSGTTLVNATASMMALGL---- 99  Terriglobus ...
jgi:Caul_4184    38 TFEigadtgdmaGEFQPWVeGLP-------LTHQIAIPGVR---HIARYSDDG-VLAIVSDM-RGRARDSVAALVL---- 101 Caulobacter ...
Q9ABN9           56 TFEigavtgdrpGEFQPWVeGLP-------LTETIAVPGLR---HPARYSPKDGVLGVMTDM-RARARESVAALLL---- 120 Caulobacter ...
WP_014403046     34 NWEngadsgdapGEYQDWVeREH-------LDQKVPVRGAP---DVVRRNAQG-----LYGMVLRHGAPDLVAFVL---- 94  Frateuria au...
WP_025293343     40 AFEigedvgdraGEYQAWAaV---------MPEVLPFPAGF---RHLRYDPARKALLLSTGIGTNRAAASTMALAL---- 103 Sphingomonas...
EMR61995         72 sacsSAQFDLHQTYFLAAGIAGVNPKLATLGGVALARFAVQVALQYEVDARELPTaaaspddhgkkgnpNLTTGYLPYGG 151 Eutypa lata ...
WP_014403493    111 ----DPRFDLSHAYWIINGIAGVDPEDASIGSVAWARYAIN-DVSRMIDPREAPA--------------TWSTGFFAEGT 171 Frateuria au...
WP_013572876    102 ----DPRFDLTHAYWLINGIAGVDPEDASIGSAAWVHYTVS-DISRFIDPREMPS--------------DWPYGYFTIGA 162 Granulicella...
jgi:AciPR4_1025 131 ----DPHFDLTHAYIIINGIAGVDPEDASIGSAAWANFVVG-DVMSEIDIREAPT--------------DWPYGLFPAGS 191 Terriglobus ...
jgi:AciX8_4548  123 ----DPRFDLSHAYLLINGIAGVDPHSASIGSAAWANYVVN-DVARAIDPREAPA--------------TWPYGIFPNGA 183 Granulicella...
jgi:Terro_4265  100 ----DPRFDLTHSYFLINGIAGVDPKYASIGSAAWAKYVVG-DVAREIDSREAPK--------------EWPYGIFPVKA 160 Terriglobus ...
jgi:Caul_4184   102 ----SPQFDLSKAYWIVSGIAGVDPKAASLGSAAWARYVVDADPIYEVDDRDIPA--------------GWPYGLYANDA 163 Caulobacter ...
Q9ABN9          121 ----DKRFDFSKTYWLVAGIAGVDPKAASIGSAAWARYVVDADPIYEVDDREIPA--------------DWPYGLYALET 182 Caulobacter ...
WP_014403046     95 ----DPRFDFSHTYWLFTGISGVDPKAAPVGSVAWARWVIDGDRARELDDRDIPK--------------GWPYGLFAIGA 156 Frateuria au...
WP_025293343    104 ----DARFDLSHAYWLVAAIAGVNPEVASVGSAAWIGDVVDTDYGYAVDPREAPA--------------GWTTGMFPRDR 165 Sphingomonas...
EMR61995        152 FA--PSDYP--TVLYG--------TEVLELNAALRDKAVDLARRggAPLADSAQVAEHRARYaaakpdgIYDAATRPPAV 219 Eutypa lata ...
WP_014403493    172 AG--PGKLPaqPPV----------PDCYPLNASLSRWAFGISREr-AKLPDTEGMAVIRQAWk------GYPNAQRPPFV 232 Frateuria au...
WP_013572876    163 VK--PNELPpaNGIIHd------rQNVYELNGALTQWAYEQTKG--VELLDVDAVKTFRGEYk------GYPNAQRPPFV 226 Granulicella...
jgi:AciPR4_1025 192 AR--PNSTIvrPG-----------FNTFALNPKLVAWAFEQTRS--LKLPDDSATEAFRAAYt------GHPNAQRPPFV 250 Terriglobus ...
jgi:AciX8_4548  184 SApkPATLPkaDWMR---------SNLYPLNPKLAAWAFAQTKD--LKLGDDPTVAEFRKGFt------GYPNAQRPPFV 246 Granulicella...
jgi:Terro_4265  161 HEpnPKTLPnaDPFK---------SNAYPLNAGLVDWAYSLTKD--LNLGDDPAVAKFRKDFv------GYPEAIRPPFV 223 Terriglobus ...
jgi:Caul_4184   164 ER--PNVKGkaEGSS---------AMVWTLDRGLVDWAYALTRD--VRLPDSPALQGLRAGYv------GDPQGQRPPFV 224 Caulobacter ...
Q9ABN9          183 ER--PNVKGsaEGSS---------GMVWALNWRLVDWAYGLTAK--VEIPDHPGLAALRAPYv------GDPNAQRPPFV 243 Caulobacter ...
WP_014403046    157 SR--PNQLPdnPNHYGsvtdvaelSQALPLNRGLADWAFQLSHT--VTLADDPVIAARRAGWk------GYPIAQRAPMV 226 Frateuria au...
WP_025293343    166 KT--PYEAPrgDAR----------YNLFPLNKGLRDWAFALTSG--IKIPDTSALREIRSAYr------HQPAAQKPPFV 225 Sphingomonas...
EMR61995        220 HACDVATSDVYYSGTLLSEAFENTTRVWTNQTEekiTYCMTAQEDVAVLEVLLRAHLWGLVDYARAIVLRTGSNFDRPPP 299 Eutypa lata ...
WP_014403493    233 LQGDSFASDYFWHGQLMNRFANDWVKLWTGGHG---QFVMTEMEDSGMMEALNRLQAMHRVDLGRVMIARAASNYSMPPP 309 Frateuria au...
WP_013572876    227 LVGDTYASDSYWHGAKMTQYANEWVKLFTKGHG---QFVMTDMEDSGYAEALQRLDRMHRVDYQRVMLLRTGSNYSMPRP 303 Granulicella...
jgi:AciPR4_1025 251 LLGDDFASDHYWYGTNLTSFANDFVKLNTGGKG---NFVMTEMEDSGIVNALARLDHIHRVDINRVLVLRTASNYSMQAP 327 Terriglobus ...
jgi:AciX8_4548  247 LMGDTFASDYYWHGKIMTQYAEDWVKLYTEGKG---TFVMTEMEDAGFMNAIERLDKMHRVDSNRVLVLRTGSNYSMQQP 323 Granulicella...
jgi:Terro_4265  224 LIGDSFASDYYWHGKIMTGYAEDWVNLYTQGNG---RFVMTNMEDSGFMEAIARLAAMKRVDARRVMVLRTGSNYSMQRP 300 Terriglobus ...
jgi:Caul_4184   225 LQGDALGTVRFWHGVRRTQWAEDWVKLWTDGAG---TFTMTDCEDQGILDVLDAHAASGRIDRRRVLVLRTASNYSRAPQ 301 Caulobacter ...
Q9ABN9          244 LKGEALGATRFWHGAKRTQWAQDWVKLWTDGAG---VFVMTDCEDQGILDVLDLYAKAGRVDFQRVMVLRTASNYSRPPL 320 Caulobacter ...
WP_014403046    227 LEGETLGAIRYWHGAARTHWAEDWVRMWTRGQG---RFVMTNEESQTYQRIMITLADEGLVDRQRIMVLRSASNFSMPPP 303 Frateuria au...
WP_025293343    226 LKGAEASGQTFWHGKLLNDHVDKWVAYWTDGGE---RFAMTAMEDSGVAGALAMAGRLGRVDPERLLVLRTGSNYSAPPP 302 Sphingomonas...
EMR61995        300 GVSAYDHLRHSDQNGF----DVAIENLYLAGSEIVRGIVTDWeCTYKAGV 345 Eutypa lata UCREL1
WP_014403493    310 GVTPLASITMEHs------dPATFEAAWAAASPVLHELLQHW-GRYR-AA 351 Frateuria aurantia
WP_013572876    304 GHTAVESVT----APYig-tRPAVENAFRVGDVVVREILAHW-TLYANKI 347 Granulicella tundricola
jgi:AciPR4_1025 328 GTTAIDSFT----SPYpggaKLAYESAWLCGSTVLHAILSHWdRAFEgnp 373 Terriglobus saanensis SP1PR4
jgi:AciX8_4548  324 GHDAVESVT----APYig-tRLALESAWLCGSTVLHNLLTHWdTTYSqip 368 Granulicella mallensis MP5ACTX8
jgi:Terro_4265  301 GHEAVESVT----APYig-tKLALESAWLCGSVALHNLLTHWdAAYAKvp 345 Terriglobus roseus DSM 18391
jgi:Caul_4184   302 GQTSLPHVFh--GEGL----KAGFDATFRVGGVVARELTAHW-DRYASDI 344 Caulobacter sp. K31
Q9ABN9          321 GAPAFPRAFh--DEGA----VSAFDSAYRVGSVVVRELTARW-DRYEANT 363 Caulobacter vibrioides
WP_014403046    304 GVSETASIGDEGpg-----qALAFDNNQRVGSVVLHQLLQHW-PQYRLRI 347 Frateuria aurantia
WP_025293343    303 GIGAADSLVa-eSSGLsa-lQASLDTAFLIGMPVVEAIDKDW-DRYRGTL 349 Sphingomonas sanxanigenens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap