Conserved Protein Domain Family
RepC

?
pfam06504: RepC 
Replication protein C (RepC)
This family consists of several bacterial replication protein C (RepC) sequences.
Statistics
?
PSSM-Id: 399484
Aligned: 4 rows
Threshold Bit Score: 469.702
Threshold Setting Gi: 347581124
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Ajs_2541    2 AFDLTHARHDPMHCLVPGLFRSLKRGERKKLKLDVTYHYAENELARFVGFEPLGADDMRLLQGLVALGGPKGIILTPEPT 81  Acidovorax sp....
WP_014003864    3 KHELTHARHDPAHCLAPGLFRSLKRGERKRGKLDVVYDYGDGKRIEFSGPEPLGADDLRILQGLVAMAGPGGLVLSPEPQ 82  Acidithiobacil...
jgi:Pnap_5004   4 KQNLDHIRHEPGHVLAPGLFRSLKKGDYKRLKLDIAYEFGKGERLEFKGAEPLGVPELRILQGLIGMAGPNGLLLTPEPK 83  Polaromonas na...
BAK85342        4 nKALTHARHDPGHVLAHGLFRSLASGDYKRLKLDVAYEIGN-ERLEFGAKEPLGTDEMRVLQGLVALAGPKGLILKADTQ 82  Komagataeibact...
jgi:Ajs_2541   82 ADLPKQLRL-FLEPKFDAV----GQDALVVRESMTSLLGEIGLTDGGDNiRAIKASLLRMANVTVVVTKGSRQRSFHLMS 156 Acidovorax sp....
WP_014003864   83 TEAGQQLRL-FLEPKWEAV----QQDAMVVKGSYRALAREIGYANPDDT-KPVRECIERLWKVSIIAQNGRKRQGFRLLS 156 Acidithiobacil...
jgi:Pnap_5004  84 TESGQQLRL-LLETKFDAI----ETNALVVKGSYRALAKTIGYADIENT-KNIQESIERLWGVSVIARKGGKHMGFRLLS 157 Polaromonas na...
BAK85342       83 SSDARQLFLdLFAPASEFVaatdQPESLVVRGSFRRLAREIGMNESGPNiTRIRQAIERLFAVTIFIQSGRRRVGCRLIS 162 Komagataeibact...
jgi:Ajs_2541  157 -YAFDEEDGRLFVALNPQIAEAILGRRPYTRIEMAEVRALQTDPARLIHQRLCGWIDPGKAGRVELDTLSGYVWPDQANA 235 Acidovorax sp....
WP_014003864  157 eYASDEQDGKLYVALNPLIARAVMGGAQHVRIDMDEVRALQTDPARLMHQRLCGWIDPGKSGRVELDTLCGYAWPSKANE 236 Acidithiobacil...
jgi:Pnap_5004 158 eYASDDADGRLYVALNPVLARAILGEAQHCRISLDEVRALKTDPARLMHQRLCGWIDIGKSGKTTIETLCGYIWLDEATP 237 Polaromonas na...
BAK85342      163 sYASDEGVGDLYVALNPRLTEAILGQGQHVRIDMEEVRGLKSDPARLMHQRLSGWINPGMRREVSIDTLCSYVWPDAGSD 242 Komagataeibact...
jgi:Ajs_2541  236 EAMKKRRQKARKALAELATVGWKVSEYAAGKWEIGRPK 273 Acidovorax sp. JS42
WP_014003864  237 NAMKRRRGIARKAIPELAALGWTVSEYAKNKFEIGRPK 274 Acidithiobacillus caldus
jgi:Pnap_5004 238 EAMKKRKQAVRRALKEMEALGWKVTEYINGKFEITRPE 275 Polaromonas naphthalenivorans CJ2
BAK85342      243 AAMRKRRQRIRSALAELRKVGW-FADVQEGVVTVGRPK 279 Komagataeibacter medellinensis NBRC 3288
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap