Conserved Protein Domain Family
DUF1100

?
pfam06500: DUF1100 
Alpha/beta hydrolase of unknown function (DUF1100)
This family consists of several hypothetical bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.
Statistics
?
PSSM-Id: 428978
Aligned: 4 rows
Threshold Bit Score: 749.01
Threshold Setting Gi: 32699808
Created: 20-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8D170   1 MAQANLSEILFKPKFKHPETSTLVRRTHCNHVVNIHSALDGDTANHWYRMINRLMWTWRGIDPLEIEEVLSRIACSKAEH 80  Yersinia pestis
P04335   1 MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIPHWYRMINRLMWIWRGIDPREILDVQARIVMSDAER 80  Escherichia coli K-12
Q87RV2   4 DVSKNLSETLFVKHKQAKETSALTQYMPTSK--KILDDREQQEDRAWYRHLRRLQWAWQGLSPIEMEGVLSRIASSTHSR 81  Vibrio parahaemolytic...
Q9KPT6   4 ASSKNLSETLFQNHKQAKETSSLTQYMPSSL--ELLDTRREQSSQAWYRNLRRLQWIWQGVDPVEQEEILARIASSKHSR 81  Vibrio cholerae O1 bi...
Q8D170  81 SNNELLDTVVGYRNGNWIYEWANQGMMWQQKAMEETDPGSAGQFWLNAANLYSIASYPHLKGDELSEQAEVLSNRAYEEA 160 Yersinia pestis
P04335  81 TDDDLYDTVIGYRGGNWIYEWATQAMVWQQKACAEDDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEA 160 Escherichia coli K-12
Q87RV2  82 THDDWLDTVMGYHSGNWTFEWIKLGMEHQRRANDLKGE-DAADELFTASLCFSIAGYPHLKNDNLALQAQVLANKAYSEG 160 Vibrio parahaemolytic...
Q9KPT6  82 THDEWLDTVMGYRSGNWTYEWTRVGMLHQKQAAERQGE-EAADQMFAAALYYSIAGYPHLRNDNLALQAQVLANNAYQEA 160 Vibrio cholerae O1 bi...
Q8D170 161 AKYLPYTLKELTFPISDGGSLSGFLHMPTvGSAPFPTVLMCGGLDTLQSDYHRLFRDYLEPKGIAMLTIDLPSVGASSRW 240 Yersinia pestis
P04335 161 AQRLPGTMRQMEFTVPGGAPITGFLHMPK-GDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRGIAMLTIDMPSVGFSSKW 239 Escherichia coli K-12
Q87RV2 161 AEKTQYTIKQIEVPYQK-RKIIANLHLPR-TDKQLPVVMVSAGLDSLQTDMWRLFRNHFAPKDIAMLTVDMPSVGHSSHW 238 Vibrio parahaemolytic...
Q9KPT6 161 AKLTGFVVKRLEFSYQN-KKIAGYLHLRN-TDSPKPVVLVSAGLDSLQTDMWRLFRDYLAKRDIAMLTIDMPSLGASSHW 238 Vibrio cholerae O1 bi...
Q8D170 241 KLTQDTSYLHQQVLQALADVPWVDHQRVSVFGFRFGANVAVRLGYLEPQRVRAVACLGPIVHHLLCNSDSLRKVPDMYMD 320 Yersinia pestis
P04335 240 KLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVRLAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLD 319 Escherichia coli K-12
Q87RV2 239 PLTEDSSCLHQAVLNELYSIPYVDHHKVGLVGFRFGGNAMVRLSFLEQEKIKACVALGAPVHDLFTSPKKLQKMPKMYLD 318 Vibrio parahaemolytic...
Q9KPT6 239 PLTEDSSCLHQAVLNQLADLPWVDHFRIGLIGFRFGGNAMARLAFLESDKVKACVSLGAPIHDIFTSPNKLAAMPKMYLD 318 Vibrio cholerae O1 bi...
Q8D170 321 VMASRLGMADSTDETLNTEMNRYSLKTQGLL-GRRCQTPMLAGFWENDPFSPKEEAKLICSSSADGKLLAIPSKPLYENF 399 Yersinia pestis
P04335 320 VLASRLGMHDASDEALRVELNRYSLKVQGLL-GRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNF 398 Escherichia coli K-12
Q87RV2 319 MLASRLGKSAVDINSMAGQMMAWSLKVQGFLsSRKTKVPILALSLEGDPVSPYSDNQLVALFSHYGQAKKISSKTITKGY 398 Vibrio parahaemolytic...
Q9KPT6 319 VLASRLGKNVVDVRSLSGQLMAWSLKVQGFMsGRRTKTPILALGLEGDPVSPYSDNQLVALFSQGGQAKKVKSKTISQGY 398 Vibrio cholerae O1 bi...
Q8D170 400 HRALLQTSEWLEDKMR 415 Yersinia pestis
P04335 399 DKGLQEITDWIEKRLC 414 Escherichia coli K-12
Q87RV2 399 EQSLDLAIKWLEDELL 414 Vibrio parahaemolyticus RIMD 2210633
Q9KPT6 399 EQSLDLAINWLEDELC 414 Vibrio cholerae O1 biovar El Tor str. N16961
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap