3OUR


Conserved Protein Domain Family
DUF1100

?
pfam06500: DUF1100 
Alpha/beta hydrolase of unknown function (DUF1100)
This family consists of several hypothetical bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.
Statistics
?
PSSM-Id: 399483
View PSSM: pfam06500
Aligned: 6 rows
Threshold Bit Score: 762.843
Threshold Setting Gi: 32699947
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3OUR_A  25 VSKNLSETLFVKHKQAKETSALTQYMPTSQ--SLLDEIKEKNGFSWYRNLRRLQWVWQGVDPIEQEQVLARIASSKHSRT 102
Q87RV2   5 VSKNLSETLFVKHKQAKETSALTQYMPTSK--KILDDREQQEDRAWYRHLRRLQWAWQGLSPIEMEGVLSRIASSTHSRT 82  Vibrio parahaemolytic...
Q7MN61   5 VSKNLSETLFVKHKQAKETSALTQYMPTSQ--SLLDEIKEKNGFSWYRNLRRLQWVWQGVDPIEQEQVLARIASSKHSRT 82  Vibrio vulnificus YJ016
Q9KPT6   5 SSKNLSETLFQNHKQAKETSSLTQYMPSSL--ELLDTRREQSSQAWYRNLRRLQWIWQGVDPVEQEEILARIASSKHSRT 82  Vibrio cholerae O1 bi...
P04335   2 TQANLSETLFKPRFKHPETSTLVRRFNHGAqpPVQSALDGKTIPHWYRMINRLMWIWRGIDPREILDVQARIVMSDAERT 81  Escherichia coli K-12
Q8D170   2 AQANLSEILFKPKFKHPETSTLVRRTHCNHvvNIHSALDGDTANHWYRMINRLMWTWRGIDPLEIEEVLSRIACSKAEHS 81  Yersinia pestis
3OUR_A 103 DEQWLDTVMGYHSGNWAYEWTRLGMEHQKRAGEMTNE-AASEALFSASLCYSIAGYPHLKSDNLAIQAQVLANSAYLEAA 181
Q87RV2  83 HDDWLDTVMGYHSGNWTFEWIKLGMEHQRRANDLKGE-DAADELFTASLCFSIAGYPHLKNDNLALQAQVLANKAYSEGA 161 Vibrio parahaemolytic...
Q7MN61  83 DEQWLDTVMGYHSGNWAYEWTRLGMEHQKRAGEMTNE-AASEALFSASLCYSIAGYPHLKSDNLAIQAQVLANSAYLEAA 161 Vibrio vulnificus YJ016
Q9KPT6  83 HDEWLDTVMGYRSGNWTYEWTRVGMLHQKQAAERQGE-EAADQMFAAALYYSIAGYPHLRNDNLALQAQVLANNAYQEAA 161 Vibrio cholerae O1 bi...
P04335  82 DDDLYDTVIGYRGGNWIYEWATQAMVWQQKACAEDDPqLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAA 161 Escherichia coli K-12
Q8D170  82 NNELLDTVVGYRNGNWIYEWANQGMMWQQKAMEETDPgSAGQFWLNAANLYSIASYPHLKGDELSEQAEVLSNRAYEEAA 161 Yersinia pestis
3OUR_A 182 KKSKYIIKQLEIPFEK-GKITAHLHLTN-TDKPHPVVIVSAGLDSLQTDMWRLFRDHLAKHDIAMLTVDMPSVGYSSKYP 259
Q87RV2 162 EKTQYTIKQIEVPYQK-RKIIANLHLPR-TDKQLPVVMVSAGLDSLQTDMWRLFRNHFAPKDIAMLTVDMPSVGHSSHWP 239 Vibrio parahaemolytic...
Q7MN61 162 KKSKYIIKQLEIPFEK-GKITAHLHLTN-TDKPHPVVIVSAGLDSLQTDMWRLFRDHLAKHDIAMLTVDMPSVGYSSKYP 239 Vibrio vulnificus YJ016
Q9KPT6 162 KLTGFVVKRLEFSYQN-KKIAGYLHLRN-TDSPKPVVLVSAGLDSLQTDMWRLFRDYLAKRDIAMLTIDMPSLGASSHWP 239 Vibrio cholerae O1 bi...
P04335 162 QRLPGTMRQMEFTVPGgAPITGFLHMPK-GDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRGIAMLTIDMPSVGFSSKWK 240 Escherichia coli K-12
Q8D170 162 KYLPYTLKELTFPISDgGSLSGFLHMPTvGSAPFPTVLMCGGLDTLQSDYHRLFRDYLEPKGIAMLTIDLPSVGASSRWK 241 Yersinia pestis
3OUR_A 260 LTEDYSRLHQAVLNELFSIPYVDHHRVGLIGFRFGGNAMVRLSFLEQEKIKACVILGAPIHDIFASPQKLQQMPKMYLDV 339
Q87RV2 240 LTEDSSCLHQAVLNELYSIPYVDHHKVGLVGFRFGGNAMVRLSFLEQEKIKACVALGAPVHDLFTSPKKLQKMPKMYLDM 319 Vibrio parahaemolytic...
Q7MN61 240 LTEDYSRLHQAVLNELFSIPYVDHHRVGLIGFRFGGNAMVRLSFLEQEKIKACVILGAPIHDIFASPQKLQQMPKMYLDV 319 Vibrio vulnificus YJ016
Q9KPT6 240 LTEDSSCLHQAVLNQLADLPWVDHFRIGLIGFRFGGNAMARLAFLESDKVKACVSLGAPIHDIFTSPNKLAAMPKMYLDV 319 Vibrio cholerae O1 bi...
P04335 241 LTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVRLAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDV 320 Escherichia coli K-12
Q8D170 242 LTQDTSYLHQQVLQALADVPWVDHQRVSVFGFRFGANVAVRLGYLEPQRVRAVACLGPIVHHLLCNSDSLRKVPDMYMDV 321 Yersinia pestis
3OUR_A 340 LASRLGKSVVDIYSLSGQMAAWSLKVQGFLsSRKTKVPILAMSLEGDPVSPYSDNQMVAFFSTYGKAKKISSKTITQGYE 419
Q87RV2 320 LASRLGKSAVDINSMAGQMMAWSLKVQGFLsSRKTKVPILALSLEGDPVSPYSDNQLVALFSHYGQAKKISSKTITKGYE 399 Vibrio parahaemolytic...
Q7MN61 320 LASRLGKSVVDIYSLSGQMAAWSLKVQGFLsSRKTKVPILAMSLEGDPVSPYSDNQMVAFFSTYGKAKKISSKTITQGYE 399 Vibrio vulnificus YJ016
Q9KPT6 320 LASRLGKNVVDVRSLSGQLMAWSLKVQGFMsGRRTKTPILALGLEGDPVSPYSDNQLVALFSQGGQAKKVKSKTISQGYE 399 Vibrio cholerae O1 bi...
P04335 321 LASRLGMHDASDEALRVELNRYSLKVQGLL-GRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFD 399 Escherichia coli K-12
Q8D170 322 MASRLGMADSTDETLNTEMNRYSLKTQGLL-GRRCQTPMLAGFWENDPFSPKEEAKLICSSSADGKLLAIPSKPLYENFH 400 Yersinia pestis
3OUR_A 420 QSLDLAIKWLEDELL 434
Q87RV2 400 QSLDLAIKWLEDELL 414 Vibrio parahaemolyticus RIMD 2210633
Q7MN61 400 QSLDLAIKWLEDELL 414 Vibrio vulnificus YJ016
Q9KPT6 400 QSLDLAINWLEDELC 414 Vibrio cholerae O1 biovar El Tor str. N16961
P04335 400 KGLQEITDWIEKRLC 414 Escherichia coli K-12
Q8D170 401 RALLQTSEWLEDKMR 415 Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap