3FHK


Conserved Protein Domain Family
Disulph_isomer

?
pfam06491: Disulph_isomer 
Click on image for an interactive view with Cn3D
Disulphide isomerase
This family of proteins has disulphide isomerase activity, EC:5.3.4.1. It has a similar fold to thioredoxin, with an alpha-beta-alpha-beta-alpha-beta-beta-alpha topology. It has a conserved CGC motif in the loop immediately downstream of the first beta strand. This motif is essential for activity.
Statistics
?
PSSM-Id: 399481
Aligned: 74 rows
Threshold Bit Score: 188.104
Threshold Setting Gi: 81388357
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FHK_F                 11 YMRQLVVPMRRELTGAGFEELTTAEEVENFMEKA-EGTTLVVVNSVCGCAAGLARPAATQAVLQNdKTPDNTVTVFAGQD 89  Bacill...
WP_015894875            2 YPENMLIPMRQELTRLGVEELRTAEDVDARIGGN-TGTMLVVVNSVCGCAARNARPAIATALAHA-VTPDASTTVFAGQD 79  Gemmat...
PRJNA194094:J421_2070   2 YPEMLVAPMRQELTRLGVTELRTPEAVDAALRDA-QGTTLVVVNSVCGCGARAARPAVAMALQHE-VKPDQLTTVFAGQD 79  Gemmat...
Q023R6                  1 --------MRQDLTRHGVEEARTPQDVDRLLGPG-SGAVLMIVNSVCGCAAGRARPAVGLALQHA-ARPARAATVFAGGD 70  Candid...
Q1IQG9                  2 YPEIMLVPMREELTRIGIEETRTADAVDDAVRGT-EGTLMVVVNSVCGCAAGKMRPGIRRAFDHA-TKPARSITVFAGQD 79  Candid...
WP_012680670            2 YPEIMVIPMREELTRVGIKEARTAADVDAALAAP--GTTMVVVNSICGCAAGKMRPGVRLALQNA-VVPDQSITVFAGQD 78  Acidob...
WP_014786700            2 YPEIMVIPMREELTRAGISEARTAAEVDQALAQS--GTTLVVVNSICGCAAGKMRPGVRMAMEHT-QKPDHAITVFAGQD 78  Terrig...
Q2S2G5                  3 YPKQMVEPMRKELTQLGVEELRTPDEVDAAFDQAeDETMLLVINSVCGCAAGNARPAVAKAKDATdHHPDRYLTVFAGQD 82  Salini...
Q2S5Z3                  3 YPKSMVEPMRKELTRLGIDELKSPDDVDAAFGAAeDETLLLIINSVCGCAAGGARPAVAQALE-TgPTPDHAVTVFAGQD 81  Salini...
Q67LR6                  5 mfvpdfQAMREELTRLGFEELRTAEEVQEKLPTA-KGVTLLAINSMCGCAGGIARPAAALALRQ--VKPDHLMTVFAGQD 81  Symbio...
3FHK_F                 90 KEATAKMRE-YFTGAAPSSPSMALLKGKEVVHFIPRHEIEGHDMEEIMKNLTAAFDAHC 147 Bacillus subtilis
WP_015894875           80 SAATERARG-YFTGYRPSSPSIALMKGAEVVFMLERHQIEGRSSAEIAADLTNAFDQYC 137 Gemmatimonas aurantiaca
PRJNA194094:J421_2070  80 VAATERARS-YFVGYPPSSPSIALLKDGQLVHMIERWQIEGRPAQAIAQDLVAAFERHC 137 Gemmatirosa kalamazoonesis
Q023R6                 71 EAAVAHLRA-RLSDYPPSSPSIALFQDGKPVYMLHRSDIERREAAEIAAILTEAFDQFC 128 Candidatus Solibacter usita...
Q1IQG9                 80 GEATDRARG-YFTGYPPSSPSIGFLREGQLVHMIQRSDIETRTADQIEALLTQAFDQYC 137 Candidatus Koribacter versa...
WP_012680670           79 REATDRARS-YFEGHPPSSPAIAILRDGKLIYLMQRAIIETNTAQAIGQELARAFNEYC 136 Acidobacterium capsulatum
WP_014786700           79 REATDKARG-YFGGHPPTSPAIAILRDGQLVYLMQRSAIEGANAPAIAQELARAFDAYC 136 Terriglobus roseus
Q2S2G5                 83 LEATERTRE-YLAGIPPSSPFFALFRDGQPVYVVERKHIEGRNADVIARDLVEAFEAYC 140 Salinibacter ruber DSM 13855
Q2S5Z3                 82 VAATDYVRDtHLPGIPPSSPFMALFRNGQPVYVIERKHIEGREPAAISADLVEALQAYC 140 Salinibacter ruber DSM 13855
Q67LR6                 82 KEATAAARA-LFPQYPPSSPSFAVLKDGQAVAMIPRSQIEGSDPQTVAQRIVEAVQAar 139 Symbiobacterium thermophilu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap