4D5T


Conserved Protein Domain Family
Orthopox_A49R

?
pfam06489: Orthopox_A49R 
Click on image for an interactive view with Cn3D
Orthopoxvirus A49R protein
This family consists of several Orthopoxvirus A49R proteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 399480
View PSSM: pfam06489
Aligned: 2 rows
Threshold Bit Score: 221.807
Threshold Setting Gi: 465050
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4D5T_B   2 VLGYVSDMHTELASISQLVIAKIETIDNDILNKDIVNFIMCRSNLDNPFISFLDTVYTIIDQENYQTELINSLDDNEIID 81  Vaccinia virus Wester...
P33857  13 VLGYVSDMHTKLASITQLVIAKIETIDNDILNNDIVNFIMCRSNLNNPFISFLDTVYTIIDQEIYQNELINSLDDNKIID 92  Variola virus human/I...
4D5T_B  82 CIVNKFMSFYKDNLENIVDAIITLKYIMNNPDFKTTYAEVLGSRIADIDIKQVIRENILQLSNDIRERYL 151 Vaccinia virus Western Reserve
P33857  93 CIVNKFMSFYKDNLENIVDAIITLKYIMNNPDFKTTYAEVLGSRIADIDIKQVIRENILQLSNDIRERYL 162 Variola virus human/India/Ind3/...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap