Conserved Protein Domain Family
L_lac_phage_MSP

?
pfam06488: L_lac_phage_MSP 
Phage tail tube protein
This is a family of Siphoviridae phage tail tube proteins including several from Lactococcus lactis.
Statistics
?
PSSM-Id: 115164
View PSSM: pfam06488
Aligned: 2 rows
Threshold Bit Score: 584.768
Threshold Setting Gi: 75089521
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9MCC0   1 MKLDYNSREIFFGNEALIVADMTKGSNGKPVFTNHKIVTGLVSVGSMEDQAETNSYPADDVPDHGVKKGATLLQGEMVFI 80  Lactococcus phage Q42
Q9MCB9   1 MKLDYNSREIFFGNEALIVADMAKGSSGKPEFSNHKIVTGLVSVGSMEDQAETNSYPADDVPDHGVKKGATLLQGEMVFI 80  Lactococcus phage Q7
Q9MCC0  81 QTDQALKEDILGQQRTENGLGWSPTGNWKTKCVQYLIKGRKRDKVTGEFVDGYRVVVYPHLTPTAEATKESETDSVDGVD 160 Lactococcus phage Q42
Q9MCB9  81 QTDQALKEDILGQQRTANGLGWSPTGNWKTKCVQYLIKGRKRDKITGEFVDGYRVVVYPHLTPTAEATKESETDSVDGVD 160 Lactococcus phage Q7
Q9MCC0 161 PIQWTLAVQATESDIYLNGDKKVPSIEYEIWGEQAKDFAKKMESGLFIIQPDTVLAGAITLVAPVIPNVTTATKGNNDGT 240 Lactococcus phage Q42
Q9MCB9 161 PIQWTLAVQATDSDIYLNGDKKVPAIEYEIWGEQAKDFVKKMESGLFIMQPDTELAGEVTLVAPTLANVQTKTKGNNDGT 240 Lactococcus phage Q7
Q9MCC0 241 IVVPDTLKDSKGRTIKVTSVIKDAHGKVATNGQLAPGVYIVTFSADGYEDVTAGVSVTDHS 301 Lactococcus phage Q42
Q9MCB9 241 IVLPATLKNSKGQDIKVTAVIKDVKGNVATNNELAPNVYIVTFSAEGYADVQAGVAVTNKP 301 Lactococcus phage Q7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap