Conserved Protein Domain Family
Endostatin

?
pfam06482: Endostatin 
Collagenase NC10 and Endostatin
NC10 stands for Non-helical region 10 and is taken from COL15A1. A mutation in this region in COL18A1 is associated with an increased risk of prostate cancer. This domain is cleaved from the precursor and forms endostatin. Endostatin is a key tumor suppressor and has been used highly successfully to treat cancer. It is a potent angiogenesis inhibitor. Endostatin also binds a zinc ion near the N-terminus; this is likely to be of structural rather than functional importance according to.
Statistics
?
PSSM-Id: 399475
View PSSM: pfam06482
Aligned: 27 rows
Threshold Bit Score: 280.783
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_013214484  1160 VTAFSNMNDMLQKAHLVIEGTFIYLRDS-AEFFIRVRDGWKKLQ------------------------------------ 1202 thirteen-lin...
24_pfamImport    1 KWVFKSKELMVKASRAVPEGSLVYVREG-SSAFLRTPTGWSRLL------------------------------------ 43  
9_pfamImport     2 VTNYKTIQALSKDAHRAAEGTLAFVAEKgGELYVRARNGWRKVQ------------------------------------ 45  
21_pfamImport    2 SKTFSSRESMMRQTSRDPEGTIFYVTST-GGLYLKVPQGWKEIQcesatltrcalsrpaar---qpdlrlrqhrstrfdr 77  
22_pfamImport    3 SKTFSTRESMMQQTVKDAEGTLAFVTTT-GSLFLKVSQGWKEIQfgktvlqkyfhvhistlvteqtalhhdhlytsvlft 81  
Q6P3M9         987 ATVLQTYQTMINLAHRLQEGTIVLVQER-SELYVRVREGFRKIL------------------------------------ 1029 tropical cla...
15_pfamImport    3 LRILSTYQAMLNKARELPEGWVIFVADR-EELYVRVRNGIRKIM------------------------------------ 45  
XP_008108790  1052 PQILPTYQSMMSRSHEVPEGQLIFIRDR-EELYIRVRNGFRKIL------------------------------------ 1094 green anole
XP_023396792  1251 VKIWATYQTMLNKVHEVPEGWLIFVAER-EELYVRVRNGFRKVL------------------------------------ 1293 African sava...
XP_014344424  1545 VMVLQTYQIMVSNARSLREGTLVFVLER-GDLYIKVRDGFRQIY------------------------------------ 1587 coelacanth
XP_013214484  1203 -LGELIPIPADsppppalssnpyqlq------------------------------------------------------ 1227 thirteen-lin...
24_pfamImport   44 -LEDPKSFLAGddpsastpqyqvrgagaagsnqspalhdggnrpyrtvlslffhlsiqeakrvqpradpegggaravpds 122 
9_pfamImport    46 -VRQLFLPLSGgpggrpalrdlppqqhhsrsvelengtsprgstarskhchpqslqmfvtlihqsr-------------- 110 
21_pfamImport   78 pTRHVVLASSClsderrdvgkdqfslstsesetrt--------------------------------------------- 112 
22_pfamImport   82 qLGSLIYLSNNiipqdeprashhvrgdtmqri------------------------------------------------ 113 
Q6P3M9        1030 -LGEYTTSSGPgqdnevaaeqapvvpyphrnkdsdylqsteensnnpnvpsgarp------------------------- 1083 tropical cla...
15_pfamImport   46 -LSHLQPLTGNqenevavvqppvfqypqsgsqfndgnnpyprrehpystakpwrsddilpg------------------- 105 
XP_008108790  1095 -LEERISLSGPgldnevydrpssvhhshgdtassgsqrtfqqhlpvhsqystystakpwrgde----------------- 1156 green anole
XP_023396792  1294 -LEARTPLPRGtvaalqppvvheghlyswqepphstarpwrsdgilanpp------------------------------ 1342 African sava...
XP_014344424  1588 -LGEYVPVTGGvqenevaavqpppvvhypqgnvvltgvgfleegdtepqrpttaapwrypepsd---------------- 1650 coelacanth
XP_013214484  1228 -----------------------------------------pplnpilsanyenpaLHLVALNMPFSGDIR----ADFQC 1262 thirteen-lin...
24_pfamImport  123 anhhrptdpickeclapgwgcvashgrggrgamgtpnpgqhcqglaetsippwhpqLRLAALNVPLSGDMSgirgADLQC 202 
9_pfamImport   111 --aykeervwkqqdqaftaplkqrdaflvkqelhdarrgyqpsynvlphtfhaipgLHLVALNNPLKGDMRgirgADFQC 188 
21_pfamImport  113 ---------------------------------qirelwkvpavvtevpvlaltlqLHLVALNQPHSGDMTgpdaADRMC 159 
22_pfamImport  114 -----------------------------------hsvkgrnnlgltpicsvfslkLNLVALNQPHSGDMMgldmADRMC 158 
Q6P3M9        1084 -------------wsdprlpepprvnpppppdhhhhgnprplepspvhthqefnpvLHLVALNTPLSGSMKsirgVDFQC 1150 tropical cla...
15_pfamImport  106 ------yprypdqsnsrhnyhgaqhhqehqhslypnlrpqypipsavhthhdfqpaLHLIALNTPLSGSMRgirgADFQC 179 
XP_008108790  1157 -----gainqhrlpeqpaiqqphhgahhqqeplnaffhqpepapsavhthhdfqpaLHLIALNTPLSGSMRgirgADFQC 1231 green anole
XP_023396792  1343 -----------------rlpdtqpypgaphyssyvhlqpgrptilpthahqdfqpvLHLVALNSPLTGGLRgirgADFQC 1405 African sava...
XP_014344424  1651 ---pqaqpqprdpsatnpvyqprrevappawypsppdrraesqpsaghshtgagpaLHLIALNTPLTGDMRgirgVDFQC 1727 coelacanth
XP_013214484  1263 FQQARAAGLLSTFRAFLSSHLQDLSTVVRKAERySLPIVNLKGQVL-------FNNWDSIFSGqgGQfNAHVPIYSFDGR 1335 thirteen-lin...
24_pfamImport  203 YRQSQEAGLYGTFRAFLSAPTQQLVSIVKRTDR-TLPIINLKGQLL-------AKSWSSLFGGqsGA-ALQGPIYSFNGR 273 
9_pfamImport   189 YQQARAMGLTSTYRAFLSSHLQDLATIVRKADRtDMPVVNLRGEVL-------FSSWMSIFSGngGTfDPSVPIYSFDGR 261 
21_pfamImport  160 HEQAEAMGLPPNYRAFVSSHRRDLVHAVYPGFReTLPVTNLRGDVM-------FRNWRSIFNGdgGPiGARVPVYSFDGR 232 
22_pfamImport  159 FEQAKAMGLAPNYRAFISSHRQDLVHVVYPGFRqTLPVTNLRGDMM-------FRNWRSIFTGngGPiNTRIPIYSFDGR 231 
Q6P3M9        1151 FEQARKAGLHGTFRAFLSSRLQDLYSIVRRADRqSVQIVNLRDEVL-------FDNWESLFSGseAQmRPGASIFSFDGK 1223 tropical cla...
15_pfamImport  180 FQQAREVGLTGTFRAFLSSRLQDLYSIVRRADRnGVPIVNLKDELL-------FNNWEALFSGseGQlKPGSRIFSFDGK 252 
XP_008108790  1232 FQQAREVGLTGTFRAFLSSRLQDLYSIVRRADRsTVPIVNLRDEVL-------FNNWENLFSGseASfRTGVRILSFDGR 1304 green anole
XP_023396792  1406 FQQARAVGLAGTFRAFLSSRLQDLHSIVRRADRaDVPIVNLKDEVL-------FPSWEALFSGseGQlRPGARIVSFDGR 1478 African sava...
XP_014344424  1728 FQQARSVGLMGTFRAFLSSRLQDLYSIVRRADRtNVPIVNLRslitaywrgrltfqMCIAF------------------- 1788 coelacanth
XP_013214484  1336 DVMTDPSWPQKVVWHGSNTHGVRLVDKYCEAWRTADMAVtGFASPLSTGKILDQQAYSCANRLIVLCIENSF 1407 thirteen-lined groun...
24_pfamImport  274 NILMDPLWPQQLAWHGSTPRGGHAHRWDCQGWRSSGTAQ-GMATALSEGRLLAGHRHNCSMPLAVLCIEVAF 344 
9_pfamImport   262 NVMTDPAWPEKLVWHGSSTVGIRLTANYCEAWRTGDMAVtGQAALLQTGRLLGQHSRSCSNHYIVLCIENTY 333 
21_pfamImport  233 DVLADPFWPQKSIWHGSTGTGTRVTDKHCETWRTDHVSVaGQSSSLAAGLLLGQQPRSCSNQYIVLCIE--- 301 
22_pfamImport  232 DVLADPFWPQKSVWHGSTSQGLRATDKHCETWRADHVSVmGQSSSLTSGLLLGQETRSCSNEYIVLCIE--- 300 
Q6P3M9        1224 DVATDPTWPQKMVWHGSDSKGRRLTESYCETWRTDEGAVtGQASSLTSGKLLEQRPQSCNKNFIVLCIENSF 1295 tropical clawed frog
15_pfamImport  253 DVLRHSSWPQKSVWHGSDSKGRRLTENYCETWRTDEAMVtGQASSLMSGKLLEQKPMSCRNAFVVLCIENSF 324 
XP_008108790  1305 DVLRNPAWPQKYVWHGSDSKGRRLTENYCETWRTDDTVVtGQASSLASGKLLEQKSSNCKNAYIVLCIENSF 1376 green anole
XP_023396792  1479 DVLRHPAWPQKSVWHGSDPSGRRLTESYCETWRTEDTMAtGQASSLLAGRLLGQKAESCRNAFIVLCIENSL 1550 African savanna elep...
XP_014344424  1789 -------RHQKMVWHGSDPKGRRLPESYCETWRAGQQAAlGQASSLFSGKLLEQRPASCSSSFIVLCIENSY 1853 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap