6NUR


Conserved Protein Domain Family
Corona_RPol_N

?
pfam06478: Corona_RPol_N 
Coronavirus RPol N-terminus
This family covers the N-terminal region of the coronavirus RNA-directed RNA Polymerase.
Statistics
?
PSSM-Id: 399472
Aligned: 7 rows
Threshold Bit Score: 589.428
Threshold Setting Gi: 212681379
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6NUR_A         16 VSAARLTPCGTGTSTDVVYRAFDIYNEKVAGFAKFLKTNCCRFQEK--------DEEgnlLDSYFVVKRHTMSNYQHEET 87  
P0C6X7       4383 VSAARLTPCGTGTSTDVVYRAFDIYNEKVAGFAKFLKTNCCRFQEK--------DEEgnlLDSYFVVKRHTMSNYQHEET 4454 Severe acute ...
P0C6X9       4468 SVNARLVPCASGLDTDVQLRAFDICNANRAGIGLYYKVNCCRFQRV--------DEDgnkLDKFFVVKRTNLEVYNKEKE 4539 Murine hepati...
Q98VG9       4038 lvqlDLEPC-NGTDPDHVSRAFDIYNKDVACIGKFLKTNCSRFRNL--------DKH----DAYYVVKRCTKSVMDHEQV 4104 Feline infect...
P0C6X1       4081 SSAARLEPC-NGTDIDYCVRAFDVYNKDASFIGKNLKSNCVRFKNV--------DKD----DAFYIVKRCIKSVMDHEQS 4147 Human coronav...
YP_002308496 3609 SSGARLEPLQHGVTPDVVQRAFHVHNNVNSGIFLSTKTNCSRFKTIrdhlplptDKA---VELYFVSKQCSQQSFEIEEK 3685 Thrush corona...
P0C6Y1       3947 SSEARLIPLASGCDPDVVKRAFDVCNKESAGMFQNLKRNCARFQELrd----teDGNleyLDSYFVVKQTTPSNYEHEKS 4022 Avian infecti...
6NUR_A         88 IYNLVKDc--------PAVAVHDFFKFRVDgdmVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDD--- 156 
P0C6X7       4455 IYNLVKDc--------PAVAVHDFFKFRVDgdmVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDD--- 4523 Severe acute ...
P0C6X9       4540 CYELTKEc--------GVVAEHEFFTFDVEgsrVPHIVRKDLSKFTMLDLCYALRHFDRNDCSTLKEILLTYAECEE--- 4608 Murine hepati...
Q98VG9       4105 CYNDLKDs--------GVVAEHDFFLYKEGrceFGNVARKDLTKYTMMDLCYAIRNFDEKNCEVLKEILVTLGACNE--- 4173 Feline infect...
P0C6X1       4148 MYNLLKGc--------NAVAKHDFFTWHEGrtiYGNVSRQDLTKYTMMDLCFALRNFDEKDCEVFKEILVLTGCCST--- 4216 Human coronav...
YP_002308496 3686 CYNLLADnikstpetfGVLARTEFFKFDK----IPNVNRQNLTKYTLLDLAYALRHLSTSK-DVIKEVLMTMCGTPE--- 3757 Thrush corona...
P0C6Y1       4023 CYEDLKS---------EVTADHDFFVFNKN---IYNISRQRLTKYTMMDFCYALRHFDPKDCEVLKEILVTYGCIEDyhp 4090 Avian infecti...
6NUR_A        157 DYF-NKKDWYDFVENPDILRVYANLGERVRQSLLKTVQFCDAMRDAGIVGVLTLDNQDLNGNWYDFGDFVQVAPGCGVPI 235 
P0C6X7       4524 DYF-NKKDWYDFVENPDILRVYANLGERVRQSLLKTVQFCDAMRDAGIVGVLTLDNQDLNGNWYDFGDFVQVAPGCGVPI 4602 Severe acute ...
P0C6X9       4609 SYF-QKKDWYDFVENPDIINVYKKLGPIFNRALLNTAKFADALVEAGLVGVLTLDNQDLYGQWYDFGDFVKTVPGCGVAV 4687 Murine hepati...
Q98VG9       4174 SFF-ENKDWFDPVENEAIHEVYARLGPIVANAMLKCVAFCDAIVEKGYIGIITLDNQDLNGNFYDFGDFVKTTPGFGCAC 4252 Feline infect...
P0C6X1       4217 DYF-EMKNWFDPIENEDIHRVYAALGKVVANAMLKCVAFCDEMVLKGVVGVLTLDNQDLNGNFYDFGDFVLCPPGMGIPY 4295 Human coronav...
YP_002308496 3758 EWF--DEQWYDPIENQTFYREFHKLGSILNRCVINANTFAKACADAGLVGILTPDNQDLLGQIYDFGDFIITQQGNGCVD 3835 Thrush corona...
P0C6Y1       4091 KWFeENKDWYDPIENSKYYVMLAKMGPIVRRALLNAIEFGNLMVEKGYVGVITLDNQDLNGKFYDFGDFQKTAPGAGVPV 4170 Avian infecti...
6NUR_A        236 VDSYYSLLMPILTLTRALAAESHMDAD-LAKPLIKWDLLKYDFTEERLCLFDRYFKYWDQTYHPNCINCLDDRCILHCAN 314 
P0C6X7       4603 VDSYYSLLMPILTLTRALAAESHMDAD-LAKPLIKWDLLKYDFTEERLCLFDRYFKYWDQTYHPNCINCLDDRCILHCAN 4681 Severe acute ...
P0C6X9       4688 ADSYYSYMMPMLTMCHALDSELFVNGT-----YREFDLVQYDFTDFKLELFTKYFKHWSMTYHPNTCECEDDRCIIHCAN 4762 Murine hepati...
Q98VG9       4253 VTSYYSYMMPLMGMTSCLESENFVKSDiYGADYKQYDLLAYDFTDHKEKLFHKYFKHWDRTYHPNCSDCTSDECIIHCAN 4332 Feline infect...
P0C6X1       4296 CTSYYSYMMPVMGMTNCLASECFMKSDiFGQDFKTFDLLKYDFTEHKEVLFNKYFKYWGQDYHPDCVDCHDEMCILHCSN 4375 Human coronav...
YP_002308496 3836 LASYYSYLMPIMSMTHMLKCECY-DSD---GNDLVYDGFQYDFTEFKLSLFSKYFTYWDRPYHPNTVDCPDDRCVLHCAN 3911 Thrush corona...
P0C6Y1       4171 FDTYYSYMMPIIAMTDALAPERYFEYD-VHKGYKSYDLLKYDYTEEKQELFQKYFKYWDQEYHPNCRDCSDDRCLIHCAN 4249 Avian infecti...
6NUR_A        315 FNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRL 368 
P0C6X7       4682 FNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRL 4735 Severe acute respiratory syndrome-relat...
P0C6X9       4763 FNILFSMVLPKTCFGPLVRQIFVDGVPFVVSIGYHYKELGVVMNMDVDTHRYRL 4816 Murine hepatitis virus strain A59
Q98VG9       4333 FNTLFSMTIPSTAFGPLVRKVHIDGVPVVVTAGYHFKQLGIVWNLDVKLDTMKL 4386 Feline infectious peritonitis virus (st...
P0C6X1       4376 FNTLFATTIPNTAFGPLCRKVFIDGVPVVATAGYHFKQLGLVWNKDVNTHSTRL 4429 Human coronavirus 229E
YP_002308496 3912 FNVLFAMCIPNTAFGNLCSQATVDGHKIIQTVGVHLKELGIVLNQDVTTHMSNi 3965 Thrush coronavirus HKU12-600
P0C6Y1       4250 FNILFSTLIPQTSFGNLCRKVFVDGVPFIATCGYHSKELGVIMNQDNTMSFSKM 4303 Avian infectious bronchitis virus (stra...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap