Conserved Protein Domain Family
DUF1090

?
pfam06476: DUF1090 
Protein of unknown function (DUF1090)
This family consists of several bacterial proteins of unknown function and is known as YqjC in E. coli.
Statistics
?
PSSM-Id: 399470
View PSSM: pfam06476
Aligned: 33 rows
Threshold Bit Score: 64.1734
Threshold Setting Gi: 122952749
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012251684        23 PATAAEsprDCSALRGCEAKFCHIENDIAAAQAQGNSRREAGLRRALSEARGSCTDASLRAERQDALAERRAEVTEREEE 102 Bordetell...
Q6D9H5              16 SHTLAN---TAGQVETCQQKAQDIQRQIDEAHKHGNQNRINGLEKALDGVKNHCTDAGLAEKRQEAIAEKRKDVAERQQE 92  Pectobact...
WP_013200545        13 SLTTFA---HAA-DSLCMQKEQGIQHEIELAKKHDNQRRVTGLERALTEAKAGCTDEKLKAQHQEKIAAHKQQVVERQKE 88  Erwinia
Q7CPR4              13 TLSAGS---YAN--SLCQEKEQDIQKEISYAEKHNNQRRIEGLNKALSEVRANCTDSKLRAEHQKKIAEQKEEVAERQRD 87  Salmonell...
wugsc:KPN_03525     13 SLSASA---LAA--SPCQEKEQDIQREISYAEKHHNQSRIDGLNTALRQVRENCSDSKLKADHQQKIAKQREEIAERQRD 87  Klebsiell...
jgi:Ddes_0625       18 LFVWAS---VAQAGGVCQKKMAHIQRQIDIARQHNNTQRAAGLERALENVRTWCTDDGEQAEAEIAVMEKQEKVQERQAE 94  Desulfovi...
zhongguo:B5T_03447  18 AALAAP---VFADQPLCGKKIAEVERQHAEARAHGHDHKARGLQRALDALRDDCTDQGLIDDARGAVDAAQQEVAERQAD 94  Alcanivor...
CBV42478            22 SQPVLA---AETVDSLCKTKAEHIQKQLRIAKEYGNEHRVRGLEKSLEGVRQHCSNERVIEDAEEDVSESMEEVRERQAE 98  Halomonas...
CCH:MU9_643         17 STSALS------AQNGCDIKKSKIQEQLSYAKAHGNTHRVQGLERALQNVNTYCTPNSLRDDARDEVSDRTKEVAERKAD 90  Morganell...
CAR45589            14 TASYAS---AETAVNGCDIKKQNIQRQIDYAKMHGNQYRVQGLERALNKVERYCTPEKVVEDTRLELREKQLEVKERELE 90  Proteus m...
WP_012251684       103 LAEARRDG-RQDKIDKALRKLKEAQDDLKE 131 Bordetella petrii
Q6D9H5              93 LSESRQKRdDAEKILKRERKLAEAEQELRA 122 Pectobacterium atrosepticum
WP_013200545        89 LEKEKADGdDSKKIAKREEKLAEAKHELKE 118 Erwinia
Q7CPR4              88 LAEAKAKG-DADKIDKRERKLAEAQDELKK 116 Salmonella enterica subsp. enterica serovar Typhimurium
wugsc:KPN_03525     88 LQEARKKG-DADKINKRQHKLNEAQQELKT 116 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
jgi:Ddes_0625       95 LDKALARDkQESKIAKRKHKLQEAQRELRE 124 Desulfovibrio desulfuricans ATCC 27774
zhongguo:B5T_03447  95 LDAAIRKG-DKDDIKKRREKLKEARQEWAE 123 Alcanivorax dieselolei B5
CBV42478            99 LAEAQQEG-DMDDIRKRSEKLEEAVMELKE 127 Halomonas elongata DSM 2581
CCH:MU9_643         91 LQKAIDKG-DISKIAKRERKLAEAEAELKE 119 Morganella morganii subsp. morganii KT
CAR45589            91 LKEAQLKG-ERDKITKREDKLAQAKAELKA 119 Proteus mirabilis HI4320
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap