Conserved Protein Domain Family
MLTD_N

?
pfam06474: MLTD_N 
MltD lipid attachment motif
This short motif is a lipid attachment site.
Statistics
?
PSSM-Id: 399468
Aligned: 13 rows
Threshold Bit Score: 38.5381
Threshold Setting Gi: 1240485967
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PRJNA200545:Achr_18230    1 MSNSPfNKDVAPGILARRTPFIVIFLAATLAGCQS 35  Azotobacter chroococcum NCIMB 8003
PRJNA283442:AA042_17265   1 MSSSI-RNSLKTDALTRLAQAIALAVSAVLAGCQS 34  Pseudomonas lundensis
WP_026013420              1 MSSLN-RKSINKDALTRLAQAIAVAVSATLAGCQS 34  Pseudomonas agarici
Q87YS7                    1 MSSSI-SKPSHSDALTRLAQAMAVTASALLAGCQS 34  Pseudomonas syringae pv. tomato
WP_043185934              1 MSSSI-RKTIKSDTLTRLAQAIAVTLCAGLAGCQS 34  Pseudomonas rhizosphaerae
WP_008368930              1 MSSTT-RKPFNSDALTRLAQAVALALPVILAGCQS 34  Pseudomonas sp. M47T1
CDZ93435                  1 MSSDT-SNRPSPDALAASGRVLALAICLAITGCQS 34  Pseudomonas saudiphocaensis
Q9I2T2                    1 MPPQT-RKTPDLDALARAVRVSILLIAGALAGCQG 34  Pseudomonas aeruginosa
WP_010794864              1 MPPQP-PHNADVDGLARTAKLSALFLAVFLAGCQG 34  Pseudomonas
PRJNA261093:LK03_14285    1 MSLRS-RRTSHSLALRRLAQASALALTATLVGCQS 34  Pseudomonas cremoricolorata
WP_097083686              1 MSSAS-RTTPTASPLTRLAQAIAVACSMVLVGCQS 34  unclassified Pseudomonas
KPY97303                  1 MPAVA-FPVSSPRLLARAVQIAVLAMGALCVGCQS 34  Pseudomonas syringae pv. spinaceae
WP_095648498              1 MTSKP-RRTLDLDALARSSRVLVAVCAAALAGCQS 34  Pseudomonas indica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap