Conserved Protein Domain Family
DUF1088

?
pfam06469: DUF1088 
Domain of Unknown Function (DUF1088)
This family is found in the neurobeachins. The function of this region is not known.
Statistics
?
PSSM-Id: 399463
View PSSM: pfam06469
Aligned: 7 rows
Threshold Bit Score: 273.621
Threshold Setting Gi: 229891179
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAD92075      532 EGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREDEKMCDHLIRAAKYRDHVTATQLIQKIIN 611  human
XP_023207505 1901 EGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESSCAQYAADRKEEEKMCDHLISAAKHRDHVTANQLKQKIVN 1980 southern plat...
XP_011663244  622 EGRLYSGLTREHLLRVANEAEFILSRHRAEDVQKHAEFESLCAQTSMDCREEEKMCDHLITAAKRRDHILASQLIQKTLN 701  purple sea ur...
A8XSV3       1534 EGRLMAHATRDHVLRVANEADFILNRLRAEDVSKHAQFEAESREQLNARYEEYSRCDLLIVSGRLRDSLNATRLLDKMSA 1613 Caenorhabditi...
Q16FK4        305 EGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCDHLITAARRRDNVIASRLLEKVRN 384  yellow fever ...
XP_023817007 1892 EGRLLCHAMKDHVVRVANEAEFILNRQRAEDVHKHAEFESHCSQYAADRREEEKMCDHLITAAKRRDHVTANQLKQKIVN 1971 Japanese medaka
XP_024215899 2022 EGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLDRREEERMCDHLITAARRRDNVIAGRLLEKICN 2101 brown marmora...
BAD92075      612 ILTD----KHGAWGN--SAVSRPLEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTAVEHATDE----DILAKGKQSI 681  human
XP_023207505 1981 ILTN----KHGAWGI--PCQSQLHDFWRLDYWEDDLRRRRRFVRNPFGSTHLDIACKSSQEYALKE----EKVVKSKLVF 2050 southern plat...
XP_011663244  702 ILTN----KHGAWGK---LTEGPREYFRLDMWEDNTRRHRRLVRDPFGSSHTEATLKAAIEHGEPE----DVVEKAKQAL 770  purple sea ur...
A8XSV3       1614 ILTDgddsKSGS------------QFWKLDVWEDDSRRRKRFVPNPYGSRHEEANLPEGEKNEEPEiseqERIRKILKGL 1681 Caenorhabditi...
Q16FK4        385 IMGN----RHGAWGDs-SGAYQKQIFWKLDAWEDDARRRKRMVQNPRGSSHPQATLKASLENGAGE----EGREPSREEI 455  yellow fever ...
XP_023817007 1972 ILTN----KHGAWGM--PSQSRLQDFWRLDYWEDDLRRRRRFVRNPYGSTHLDVACKSLQEYALKE----DEVVKSKLVF 2041 Japanese medaka
XP_024215899 2102 ILSN----KHGAWGYvdPNATKLSEFWKLDAWEDDARRRKRLIHNPRGSSHPQATLKAAIEHGAPD----DAILQARNEF 2173 brown marmora...
BAD92075      682 RSQALGNQNSE---NEILLEG 699  human
XP_023207505 2051 RSPTLASQNPE---TELVLDG 2068 southern platyfish
XP_011663244  771 HAQIASKQRGSqasdaaeede 791  purple sea urchin
A8XSV3       1682 FSQRHATTTSTg-gQELVDES 1701 Caenorhabditis briggsae
Q16FK4        456 YSQIAVPRSQQ---PDLLDDS 473  yellow fever mosquito
XP_023817007 2042 RNPVVPIQNPE---TELILDG 2059 Japanese medaka
XP_024215899 2174 HAQLAASYSQQvqsTDLLDDG 2194 brown marmorated stink bug
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap