3D34,3Q13


Conserved Protein Domain Family
Spond_N

?
pfam06468: Spond_N 
Spondin_N
This conserved region is found at the in the N-terminal half of several Spondin proteins. Spondins are involved in patterning axonal growth trajectory through either inhibiting or promoting adhesion of embryonic nerve cells.
Statistics
?
PSSM-Id: 399462
View PSSM: pfam06468
Aligned: 51 rows
Threshold Bit Score: 223.995
Threshold Setting Gi: 190589833
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3D34_A        15 AKYSITFTGKWSQTA----FPKQYPLFRPpaQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEA------------- 77  
XP_002607869  60 GKYRMTFYGLWSQQT----HPKDYPKYGT--HWSAIIGATHSKDYSIWEYGGYSTEGVKQVAEWGSP------------- 120  Florida lancelet
ELK18044     205 AKYRLTFYGNWSEKT----HPKDYPRRAN--HWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSP------------- 265  black flying fox
EDO49895       8 ATYKLTFKGKWSQET----HARHHPGPMA--RWSPLIGCSHSNKYVMWRYGGIASRAVQMMSEWGAT------------- 68   starlet sea an...
EDV29855      32 ATYTVVFTGLWANNNnypnYPTNFP------HWSPLIGAIHSPAVTVYAYGQYASTQVKSVAENGNAvp----------- 94   Trichoplax adh...
EDV29856     291 ATYELTFEGIWVNSSaypfYPSNFP------HWSTFIGAIHSPALTVYSYGQYASPEVESVAEAGNAgp----------- 353  Trichoplax adh...
XP_002117808  29 ATYSMKFKGIWNKET----HPKDFPT-RSfpRWGNLIGATHSQTFYLYHYNTIVSTFMKEAAEWDFA------------- 90   Trichoplax adh...
3Q13_A        21 AKYRLTFYGNWSEKT----HPKDYPRRAN--HWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSP------------- 81  
XP_002109058  33 ATYRITFEGIWTNTAsypyYPTNFP------HWSPFIGAIHSPAVTVYEYGKYASSQVKSVAEAGQArknknkikiirhi 106  Trichoplax adh...
XP_018673350 218 ATYHMTFYGLWSPTS----HPKDYPAFST--HWSNVIGASHSSEYSIWDYGEFASPAVQKVAEWGWP------------- 278  vase tunicate
3D34_A        78 ---------------------------------WALMKEIEA--AGealQSVHEVFSAPAV------P-----SGTGQTS 111 
XP_002607869 121 ---------------------------------TKLEREMKE--QG---NNIRTVVKTDPQwpayepR-----NIKAPVS 157  Florida lancelet
ELK18044     266 ---------------------------------VKMEEEIRQ--QS---DEVLTVIKAKAQwpawqpL-----NVRAAPS 302  black flying fox
EDO49895      69 ---------------------------------EYLDEEMRN--QQ---ENVMSIIQTPSLw-----Y-----GVG-ESS 99   starlet sea an...
EDV29855      95 --------------------------------lKALLEPMTN--------NVKQVFVSTGSs-----L-----QPTATYS 124  Trichoplax adh...
EDV29856     354 --------------------------------lKNLLTPMTD--------KVKKVFVSPGAy-----L-----GPTAKYT 383  Trichoplax adh...
XP_002117808  91 ---------------------------------AKLLRDIISnkNR----RVFDYFTIRSNf-----------DIHQTEA 122  Trichoplax adh...
3Q13_A        82 ---------------------------------VKMEEEIRQ--QS---DEVLTVIKAKAQw-----PawqplNVRAAPS 118 
XP_002109058 107 llmdllqiithnyravmmlifahviylvlieplKNLLTPMTS--------KVKKVFVSPGGs-----L-----GPTAKYS 168  Trichoplax adh...
XP_018673350 279 ---------------------------------NDVETEVTS--QG---DHVMSLIKTPAQwpayqpR-----NLRNPPS 315  vase tunicate
3D34_A       112 AELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCD-GDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSS 190 
XP_002607869 158 SDFGVDSEHHLLSFLTMLGPSPDWNVGLSNFDVCQgD-QWLDRTEMDLYPWDAGTDSGITYESANSPTIPREKIRPITSQ 236  Florida lancelet
ELK18044     303 AEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTkDCGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTSL 382  black flying fox
EDO49895     100 AVFRVDSTRHLLSMISRMIPSPDWNVGVDRVNLCTtNCTWKHEETIDLIPWDAGTDDGITFKSPNARSTPKQPISRITTR 179  starlet sea an...
EDV29855     125 VTVNVDNNFNLLSALTMIAPSPDWCVGVDRVNFCTsSCGFIASKTIDLYLWDAGTKAAATEQYSYTGSLTRVPIYQIKTS 204  Trichoplax adh...
EDV29856     384 VTVDVNKNFNLLSALTMIAPSPDWCVGVSRVNFCTkQCGFIGNTTLDLYLWDAGTKAGPTEQYTYAGSATNRTIYQLKST 463  Trichoplax adh...
XP_002117808 123 VSFTVDQMHHLVSFVRKISPSPDWFVGMDSLDLCKsDCNWRDSLIVNLTLLDAGTDDGISYTSPNHPTEPQKTVQKITAL 202  Trichoplax adh...
3Q13_A       119 AEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTkECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTSL 198 
XP_002109058 169 VTVDVDNNFNLLSALTMIAPSPDWCVGVSRLNFCTkQCGFIGNTTMDLYLWDAGTKAGAAEQYTYTGSTTNRTIYQLKST 248  Trichoplax adh...
XP_018673350 316 DTFQVDQSRHLVSLLSMLGPSPDWNVGITKETMCTlECGWIGTRVYNLTPWDAGTDSGVSYLSANSATTPHERIRALTSA 395  vase tunicate
3D34_A       191 SPSHPANSFYYP 202 
XP_002607869 237 DPKNPASPWYNT 248  Florida lancelet
ELK18044     383 D--HPQSPFYDP 392  black flying fox
EDO49895     180 LHDHPRASFYLN 191  starlet sea anemone
EDV29855     205 --NQSASVFYRA 214  Trichoplax adhaerens
EDV29856     464 --NDSSSVFYRA 473  Trichoplax adhaerens
XP_002117808 203 FSNNSSSPFYVN 214  Trichoplax adhaerens
3Q13_A       199 D--HPQSPFYDP 208 
XP_002109058 249 --NDSSSVFYRA 258  Trichoplax adhaerens
XP_018673350 396 D--DPESPFYKE 405  vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap