3R24


Conserved Protein Domain Family
NSP13

?
pfam06460: NSP13 
Coronavirus NSP13
This family covers the NSP13 region of the coronavirus polyprotein. This protein has the predicted function of an mRNA cap-1 methyltransferase function.
Statistics
?
PSSM-Id: 399456
View PSSM: pfam06460
Aligned: 6 rows
Threshold Bit Score: 564.052
Threshold Setting Gi: 190360108
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3R24_A   48 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPG 127 
P0C6X7 6777 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPG 6856 Severe acute respir...
P0C6X9 6879 AADWKPGYVMPVLYKYLESPLERVNLWNYGKPITLPTGCMMNVAKYTQLCQYLSTTTLAVPANMRVLHLGAGSDKGVAPG 6958 Murine hepatitis vi...
P0C6Y1 6327 qSAWTCGYNMPELYKVQNCVMEPCNIPNYGVGITLPSGILMNVAKYTQLCQYLSKTTICVPHNMRVMHFGAGSDKGVAPG 6406 Avian infectious br...
Q98VG9 6410 sAEWNPGYSMPTLYKIQRMCLERCNLYNYGAQVRLPDGITTNVVKYTQLCQYLNTTTVCVPHKMRVLHLGAAGASGVAPG 6489 Feline infectious p...
P0C6X1 6459 SAEWKCGYSMPGIYKTQRMCLEPCNLYNYGAGLKLPSGIMFNVVKYTQLCQYFNSTTLCVPHNMRVLHLGAGSDYGVAPG 6538 Human coronavirus 229E
3R24_A  128 TAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMY----DPRTKHVTKENDSKEGFFTYLCGFI 203 
P0C6X7 6857 TAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMY----DPRTKHVTKENDSKEGFFTYLCGFI 6932 Severe acute respir...
P0C6X9 6959 SAVLRQWLPAGSILVDNDVNPFVSDSVASYYGNCITLPFDCQWDLIISDMY----DPLTKNIGEYNVSKDGFFTYLCHLI 7034 Murine hepatitis vi...
P0C6Y1 6407 STVLKQWLPEGTLLVDNDIVDYVSDAHVSVLSDCNKYNTEHKFDLVISDMYtdndSKRKHEGVIANNGNDDVFIYLSSFL 6486 Avian infectious br...
Q98VG9 6490 STVLRRWLPDDAILVDNDLRDYVSDADFSVTGDCTSLYIEDKFDLLISDLY----DGSTKSIDGENTSKDGFFTYINGFI 6565 Feline infectious p...
P0C6X1 6539 TAVLKRWLPHDAIVVDNDVVDYVSDADFSVTGDCATVYLEDKFDLLISDMY----DGRTKAIDGENVSKEGFFTYINGFI 6614 Human coronavirus 229E
3R24_A  204 KQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGK--PKEQIDGYTMHANYIFWRNTN 281 
P0C6X7 6933 KQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGK--PKEQIDGYTMHANYIFWRNTN 7010 Severe acute respir...
P0C6X9 7035 RDKLALGGSVAIKITEFSWNAELYSLMGKFAFWTIFCTNVNASSSEGFLIGINWLNK--TRTEIDGKTMHANYLFWRNST 7112 Murine hepatitis vi...
P0C6Y1 6487 RNNLALGGSFAVKVTETSWHEVLYDIAQDCAWWTMFCTAVNASSSEAFLIGVNYLGAs-EKVKVSGKTLHANYIFWRNCN 6565 Avian infectious br...
Q98VG9 6566 KEKLSLGGSAAIKITEFSWNKDLYELIQRFEYWTVFCTSVNTSSSEGFLIGINYLGPycDKAIVDGNIMHANYIFWRNST 6645 Feline infectious p...
P0C6X1 6615 CEKLAIGGSIAIKVTEYSWNKKLYELVQRFSFWTMFCTSVNTSSSEAFVVGINYLGDfaQGPFIDGNIIHANYVFWRNST 6694 Human coronavirus 229E
3R24_A  282 PIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVN 343 
P0C6X7 7011 PIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVN 7072 Severe acute respiratory syndrome-rel...
P0C6X9 7113 MWNGGAYSLFDMSKFPLKAAGTAVVSLKPDQINDLVLSLIEKGKLLVRDTRKEVFVGDSLVN 7174 Murine hepatitis virus strain A59
P0C6Y1 6566 YLQTSAYSIFDVAKFDLRLKATPVVNLKTEQKTDLVFNLIKCGKLLVRDVGNTSFTSDSFVC 6627 Avian infectious bronchitis virus (st...
Q98VG9 6646 IMALSHNSVLDTPKFKCRCNNALIVNLKEKELNEMVVGLLRKGKLLIRNNGKLLNFGNHLVN 6707 Feline infectious peritonitis virus (...
P0C6X1 6695 VMSLSYNSVLDLSKFNCKHKATVVVQLKDSDINEMVLSLVRSGKLLVRGNGKCLSFSNHLVS 6756 Human coronavirus 229E
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap