1ECI,1ECI


Conserved Protein Domain Family
Ectatomin

?
pfam06457: Ectatomin 
Click on image for an interactive view with Cn3D
Ectatomin
Ectatomin is a toxic component from the Ectatomma tuberculatum ant venom. It is comprised of two subunits, A and B, which are homologous. The structure of ectatomin reveals that each subunit is comprised of two helices and a connecting hinge region, the forms a hairpin structure that is stabilized by disulphide bridges. The two hinges are connected by a disulphide bond.
Statistics
?
PSSM-Id: 115133
View PSSM: pfam06457
Aligned: 4 rows
Threshold Bit Score: 44.2844
Threshold Setting Gi: 1352338
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ECI_A  3 IPKKIWETVCPTVEPWAKKCSGDIATYIKRECGK 36 
P49344  1 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK 34  Ectatomma tuberculatum
P49343  3 IPKKIWETVCPTVEPWAKKCSGDIATYIKRECGK 36  Ectatomma tuberculatum
1ECI_B  1 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK 34 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap