Conserved Protein Domain Family

pfam06454: DUF1084 
Protein of unknown function (DUF1084)
This family consists of several hypothetical plant specific proteins of unknown function.
PSSM-Id: 399452
Aligned: 17 rows
Threshold Bit Score: 308.878
Threshold Setting Gi: 122056956
Created: 21-May-2020
Updated: 7-Aug-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
EDP05347     265 LNIAYYGLAEILPSAAVLYILRKLPPKRQNAQGYQ 299 Chlamydomonas reinhardtii
XP_001778362 256 LNAIYYTLVEIVPSALVLYILRKLPPKRLSGQYHP 290 Physcomitrella patens
EFJ23006     248 LDTVVYLLVEILPSALVLYILRKLPPNRpgppgye 282 Selaginella moellendorffii
XP_002979144 260 LNFLYFLLVEILPSALVLYILRKLPAKRATSTAYK 294 Selaginella moellendorffii
XP_011626514 276 LNLIYYTLVEIVPSALVLFILRKLPPKRVSDQYHP 310 Amborella trichopoda
XP_009419586 344 LDLIYYTLTEILPSVLVLYILRKLPPRRVSGQYHP 378 wild Malaysian banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap