Conserved Protein Domain Family
SEF14_adhesin

?
pfam06443: SEF14_adhesin 
SEF14-like adhesin
Family of enterotoxigenic bacterial adhesins.
Statistics
?
PSSM-Id: 115120
View PSSM: pfam06443
Aligned: 2 rows
Threshold Bit Score: 226.075
Threshold Setting Gi: 462119
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q47405   2 RSKLSILIFALMTCGAANAATAVGDVATVRAPLVFSAQNTINATWTQDSSVSGSSVTAMQKLGTLNIRLTGSHAGVYVSG 81  Escherichia coli
P12061   3 KSASAVAVLALIACGSAHAAGFVGNKAVVQAAVTIAAQNTTSANWSQDPGFTGPAVAAGQKVGTLSITATGPHNSVSIAG 82  Salmonella enterica s...
Q47405  82 DDTGESGGLITIPFKNTAGQVLFRGRTNAEIGQAMTTPIVGHSGpGWHLPGTQDNFNLDIRAFqNANNIPAGEYTATFYI 161 Escherichia coli
P12061  83 KGASVSGGVATVPFVDGQGQPVFRGRIQGANINDQANTGIDGLA-GWRVASSQETLNVPVTTF-GKSTLPAGTFTATFYV 160 Salmonella enterica s...
Q47405 162 QQYQS 166 Escherichia coli
P12061 161 QQYQN 165 Salmonella enterica subsp. enterica serovar Enteritidis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap