Conserved Protein Domain Family
DHFR_2

?
pfam06442: DHFR_2 
R67 dihydrofolate reductase
R67 dihydrofolate reductase is a plasmid encoded enzyme that provides resistance to the antibacterial drug trimethoprim. The R67 dihydrofolate reductase does not share significant similarity to the chromosomal encoded dihydrofolate reductase.
Statistics
?
PSSM-Id: 368910
View PSSM: pfam06442
Aligned: 3 rows
Threshold Bit Score: 160.211
Threshold Setting Gi: 118970
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P00384    1 MGQSSDEANAPVAGQFALPLSATFGLGDRVRKKSGAAWQGQVVGWYCTKLTPEGYAVESESHPGSVQIYPVAALERVA 78  Escherichia coli
CAT00055  1 MERSSNEVSNPVAGNFVFPSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN 78  Aeromonas sobria
ABN79864  1 MNEGKNEVSTSAAGRFAFPSNATFALGDRVRKKSGAAWQGRIVGWYCTTLTPEGYAVESESHPGSVQIYPMTALERVA 78  Aeromonas encheleia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap