Conserved Protein Domain Family

pfam06432: GPI2 
Phosphatidylinositol N-acetylglucosaminyltransferase
Glycosylphosphatidylinositol (GPI) represents an important anchoring molecule for cell surface proteins. The first step in its synthesis is the transfer of N-acetylglucosamine (GlcNAc) from UDP-N-acetylglucosamine to phosphatidylinositol (PI). This step involves products of three or four genes in both yeast (GPI1, GPI2 and GPI3) and mammals (GPI1, PIG A, PIG H and PIG C), respectively.
PSSM-Id: 399439
Aligned: 141 rows
Threshold Bit Score: 141.538
Threshold Setting Gi: 74777353
Created: 21-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
ERS98169     291 VGWGSIATCMGWLLWEWWAGQeqqerqaegldddddyvgnssrapsrndldgfpspngqrmgrrgnggtasvasvasvas 370 Sporothrix sche...
Q5CSB5        82 ALLDLSLLSIMYIFI----------------------------------------------------------------- 96  Cryptosporidium...
XP_001568810 143 VVIDVLSVLAALVCYVFYQCHqgncrata--------------------------------------------------- 171 Leishmania braz...
Q4D6T1       109 AWINTTLFALSFVFYVEMQRQ----------------------------------------------------------- 129 Trypanosoma cruzi
Q38AZ2       115 MWVNATLFTLAFVFCIVVQRQ----------------------------------------------------------- 135 Trypanosoma brucei
XP_006848133  84 LSLDAVLLGLGFLVL----------------------------------------------------------------- 98  Amborella trich...
XP_009143718  98 LLLDLSLLALGFLVL----------------------------------------------------------------- 112 field mustard
XP_006369058  88 LLLDASLFGSGFLVL----------------------------------------------------------------- 102 black cottonwood
KRH24063      90 LLIDVGLLVSGFLIL----------------------------------------------------------------- 104 soybean
XP_006345740  93 LLLNVSLLGSGFFIL----------------------------------------------------------------- 107 potato
ERS98169     371 atsaasgdqsppmsslaphsapssqsasrlskhseastvdttpslatstnsstsfldmstrhsrvgsgkghapyansnvs 450 Sporothrix sche...
Q5CSB5           --------------------------------------------------------------------------------     Cryptosporidium...
XP_001568810     --------------------------------------------------------------------------------     Leishmania braz...
Q4D6T1           --------------------------------------------------------------------------------     Trypanosoma cruzi
Q38AZ2           --------------------------------------------------------------------------------     Trypanosoma brucei
XP_006848133     --------------------------------------------------------------------------------     Amborella trich...
XP_009143718     --------------------------------------------------------------------------------     field mustard
XP_006369058     --------------------------------------------------------------------------------     black cottonwood
KRH24063         --------------------------------------------------------------------------------     soybean
XP_006345740     --------------------------------------------------------------------------------     potato
ERS98169     451 ghgngngsvgtgrstgtststssswqpvghssslsqvsngsnttngpaassshrpasshgrsaagaehhvpitpatpryp 530 Sporothrix sche...
Q5CSB5           --------------------------------------------------------------------------------     Cryptosporidium...
XP_001568810     --------------------------------------------------------------------------------     Leishmania braz...
Q4D6T1           --------------------------------------------------------------------------------     Trypanosoma cruzi
Q38AZ2           --------------------------------------------------------------------------------     Trypanosoma brucei
XP_006848133     --------------------------------------------------------------------------------     Amborella trich...
XP_009143718     --------------------------------------------------------------------------------     field mustard
XP_006369058     --------------------------------------------------------------------------------     black cottonwood
KRH24063         --------------------------------------------------------------------------------     soybean
XP_006345740     --------------------------------------------------------------------------------     potato
ERS98169     531 pprrpltpvrgGRGHHR----------IATIK-------------SAVLIYFTLLGLSPILKSLTRSTSSDSIWAMSFWL 587 Sporothrix sche...
Q5CSB5        97 ---------------------------SPNV--------------NLLVIFGFLWLVSPILITLTASFSDDTIIALCTIA 135 Cryptosporidium...
XP_001568810 172 ---erhasrstRCSSPSrppsqwvfhaWNFGR-------------QVVSLVTMLTLLSPILSTLTVTYSDDTIVTLSILT 235 Leishmania braz...
Q4D6T1       130 -----------QAMEQGetptpllqhvVKLGR-------------QVLPLVAVIILLSPALQTLTATYSNDTIVALSTFA 185 Trypanosoma cruzi
Q38AZ2       136 -----------QAVDRGeiptpfthylMGLCR-------------QGIPLVGVLILLSPVLQTLTVAYSNDTIVTLSSLS 191 Trypanosoma brucei
XP_006848133  99 ---------------------------LLTERrlslpl-lskyflNIGFFICGLYVLAPLFHTLTRSISSDSIWALTVSL 150 Amborella trich...
XP_009143718 113 ---------------------------LLTEEkmlslrlllryvtNITFFTTGLYVLAPVYQTLTRSISSDSIWAVTVSL 165 field mustard
XP_006369058 103 ---------------------------LLTKEmrslnl-lfyyilNISFFTTGLYMLAPIYHTLTRSISSDSIWAVTVSL 154 black cottonwood
KRH24063     105 ---------------------------LFTQEmlslsl-lfhyflNISFFITVLYVLAPIYQTLTRSISSDSIWAVAASL 156 soybean
XP_006345740 108 ---------------------------LLTADmipfnl-llnyllKNTFFITALYMLSPIYHTLTRSISSNSIWALTASL 159 potato
ERS98169     658 RSWQYHIGLTVLLVLGAGAGVGIILTepsdglpwrgatAGMVVACLLSAVAMGGCSWWL--------------------- 716 Sporothrix sche...
Q5CSB5       209 --------------------------------------NLPKVYLYVLTPITSITPIWFlyyplnivytiicaviisgti 250 Cryptosporidium...
XP_001568810 305 YSFTAHVATTFGLVGLAIGCLTQIP-------------ILAILYTVTVLMISFGIPWLF--------------------- 350 Leishmania braz...
Q4D6T1       255 TSATAHVGLTFALCGLAAGCLMQAA-------------IFAVLYCLLVVAVSLFIPWCF--------------------- 300 Trypanosoma cruzi
Q38AZ2       261 VSLRAHVVLTFTICALAIYFLMEVP-------------VFALLYCVVVVVISVVIPFFF--------------------- 306 Trypanosoma brucei
XP_006848133 226 YSVKAHLWFSFTLTCSTLAIIFPINR------------LVFVIFLGLLLFVTVVCPYWL--------------------- 272 Amborella trich...
XP_009143718 241 FSFGLHLGFSFALMGLTMYSVYALHR------------LFFVLFLVLVVVVNVVCPYWL--------------------- 287 field mustard
XP_006369058 230 FSFHLHLLFSFGLMVVTLALVYTLHH------------LLFMLLFGLLLFISIICPYWL--------------------- 276 black cottonwood
KRH24063     232 YSFRLHLCFSISLMAMTLSFVYTLHR------------LLFVLLLSLLVFVNVVCPYWL--------------------- 278 soybean
XP_006345740 235 RSFKLHICFSLQLLVLTLVFTYQLHK------------LLFIVLLGIFVFVNLVCPYWL--------------------- 281 potato
ERS98169     717 --IGLQ-KYKNEIYGPWD 731 Sporothrix schenckii ATCC 58251
Q5CSB5       251 lyVYCGsNYKNVIFGPWD 268 Cryptosporidium parvum
XP_001568810 351 --VRMHsSVKTQINGPWD 366 Leishmania braziliensis MHOM/BR/75/M2904
Q4D6T1       301 --VTLHgSMKKQINGPWD 316 Trypanosoma cruzi
Q38AZ2       307 --VKLHgSMKDQINGPWD 322 Trypanosoma brucei
XP_006848133 273 --IRMQ-EYKFEIEGPWD 287 Amborella trichopoda
XP_009143718 288 --IRMQ-EYKFEINGPWD 302 field mustard
XP_006369058 277 --IRIQ-EYKFEINGPWD 291 black cottonwood
KRH24063     279 --IRIQ-EYKFEINGPWD 293 soybean
XP_006345740 282 --IRIQ-EYKFEINGPWD 296 potato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap